Gene Information

Name : Bcep18194_B0270 (Bcep18194_B0270)
Accession : YP_371030.1
Strain :
Genome accession: NC_007511
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 288049 - 288624 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCACTGACTCTTCAAAAAGGCGGCAACCTCTCGCTCTCCAAAACCGACCCGAGCCTGACCAGGATCCTGGTTGGCCT
GGGCTGGGACCCGCGCGCGACCGACGGCACCGAGTTCGATCTCGACGCCAGCGCGTTCCTGCTGGGGGCCAACGGCAAAG
TCCGCGGTGAAGCCGACTTCATCTTCTACAACCAATTGCGCAGCCAGGACGGTTCTGTCGAACATACCGGCGACAACCGT
ACCGGCGCTGGCGACGGCGACGACGAAGTCCTCAAGGTCGACCTGAGCCGCGTTCCGGCCGACATCGACAAGATCGCCTT
CACCGTCACCATCCACGACGCCGAAGCGCGCAAGCAGAACTTCGGCCAGGTCAGCAATTCGTTCATCCGCGTCGTGAACG
AGACCTCCGGTGCAGAGGTGGTCCGCTACGACCTGGCGGAGGACGCCTCCACCGAAACCGCGATGATCTTCGCGGAGTTG
TACCGCAGCAGCGGCGAGTGGAAATTCCGCGCCGTGGGCCAAGGCTACGCCGGCGGCCTGCGTGCCCTGGCCAACAGCTA
CGGCATGAACTTCTGA

Protein sequence :
MALTLQKGGNLSLSKTDPSLTRILVGLGWDPRATDGTEFDLDASAFLLGANGKVRGEADFIFYNQLRSQDGSVEHTGDNR
TGAGDGDDEVLKVDLSRVPADIDKIAFTVTIHDAEARKQNFGQVSNSFIRVVNETSGAEVVRYDLAEDASTETAMIFAEL
YRSSGEWKFRAVGQGYAGGLRALANSYGMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-76 84
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-66 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-66 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-66 69
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-57 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-59 65
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-30 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-27 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep18194_B0270 YP_371030.1 stress protein BAC0389 Protein 3e-66 71
Bcep18194_B0270 YP_371030.1 stress protein BAC0390 Protein 2e-61 65
Bcep18194_B0270 YP_371030.1 stress protein BAC0392 Protein 2e-26 41