Gene Information

Name : Tcr_2075 (Tcr_2075)
Accession : YP_392339.1
Strain : Thiomicrospira crunogena XCL-2
Genome accession: NC_007520
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2295416 - 2295724 bp
Length : 309 bp
Strand : +
Note : -

DNA sequence :
ATGACAAAAACAAGACCAACATTTTCAGCCGAGTTTAAACTCGAATCAGCCCAACTGGTTGTTGACCAAGGCTACACACT
AAATGAAGCCGCAAAAGCCATGGGCGTGGGCTTATCCACCATGGGTAAGTGGGTGAAGCAACTTAAAGATGAGCGCCGTG
GCATTGCCCCAAAAGGCAGCGCACTTACACCCGAGCAGATTGAAATCCAACAATTAAAAAAGCGGATTAAGTACCTCGAA
GAGGAAAAAGACATATTAAAAAAGGCTACCGCGCTCTTGATGTCGGACTCGTTCAACAGTTCGAGATAA

Protein sequence :
MTKTRPTFSAEFKLESAQLVVDQGYTLNEAAKAMGVGLSTMGKWVKQLKDERRGIAPKGSALTPEQIEIQQLKKRIKYLE
EEKDILKKATALLMSDSFNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-28 69
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-28 69
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-27 68
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-24 67
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-28 67
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 67
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-28 67
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 67
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-28 67
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 67
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 67
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 67
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 63
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-24 59
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-24 56
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-24 56
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-24 56
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-24 56
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-25 55
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-25 55
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-13 48
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 8e-12 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-17 43
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-17 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG1485 Protein 9e-29 69
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG1123 Protein 9e-29 67
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG1553 Protein 5e-25 63
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG0784 Protein 2e-24 56
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG1566 Protein 1e-13 48
Tcr_2075 YP_392339.1 transposase IS3/IS911 VFG1521 Protein 3e-12 46