Gene Information

Name : LSA1384 (LSA1384)
Accession : YP_395994.1
Strain : Lactobacillus sakei 23K
Genome accession: NC_007576
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1352199 - 1352885 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGAGTCGCATATTAATTATTGAAGATGAGAAAAATTTAGCCCGGTTTGTTGAGCTTGAATTAAAGCACGAAGGCTATGG
GACCGAAGTACATTTCAATGGGCGTACTGGTTTAGAAGCTGCTTTAAACGAAGACTGGGATTCAATTTTATTGGATCTAA
TGTTACCTGAATTAAATGGGTTAGAAGTTTGCCGACGGGTTCGACAAGTTAAAAATACACCGATTATCATGATGACAGCG
CGCGATTCCGTTATTGATCGGGTATCAGGGCTTGATCATGGTGCTGACGATTATATCGTTAAACCATTTGCGATTGAAGA
ACTTTTAGCCCGGCTACGCGCCTTGTTACGCCGGATCGATATTGAAGGCGAACATAACGCTGCCAAACAAACGACGGTGA
CTTATCGCGATTTAACAGTCGAGAAGGAAAACCGAATTGTTCGTCGTGGTGATGATATTATTGAATTAACGAAACGTGAA
TACGAATTACTATTAACCTTAATGGAAAACGTTAACGTGGTCTTAGCGCGGGATGTCTTGTTAAGCAAGGTCTGGGGTTA
TGATTCCGACGTTGAAACGAACGTGGTCGATGTTTATATTCGTTATTTGCGGAATAAAATCGATCGAACGGGCGAACAAA
GCTATATTCAAACCGTTCGGGGAACTGGATATGTGATGCGCTCGTGA

Protein sequence :
MSRILIIEDEKNLARFVELELKHEGYGTEVHFNGRTGLEAALNEDWDSILLDLMLPELNGLEVCRRVRQVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALLRRIDIEGEHNAAKQTTVTYRDLTVEKENRIVRRGDDIIELTKRE
YELLLTLMENVNVVLARDVLLSKVWGYDSDVETNVVDVYIRYLRNKIDRTGEQSYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSA1384 YP_395994.1 two-component system response regulator HE999704.1.gene1528. Protein 6e-79 73
LSA1384 YP_395994.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-48 53
LSA1384 YP_395994.1 two-component system response regulator AE015929.1.gene1106. Protein 7e-44 52
LSA1384 YP_395994.1 two-component system response regulator BAC0308 Protein 5e-31 44
LSA1384 YP_395994.1 two-component system response regulator BAC0125 Protein 2e-29 44
LSA1384 YP_395994.1 two-component system response regulator BAC0197 Protein 7e-28 43
LSA1384 YP_395994.1 two-component system response regulator BAC0083 Protein 3e-28 42
LSA1384 YP_395994.1 two-component system response regulator BAC0638 Protein 2e-25 42
LSA1384 YP_395994.1 two-component system response regulator NC_012469.1.7685629. Protein 6e-37 41
LSA1384 YP_395994.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSA1384 YP_395994.1 two-component system response regulator VFG1390 Protein 7e-37 45
LSA1384 YP_395994.1 two-component system response regulator VFG0596 Protein 1e-28 43
LSA1384 YP_395994.1 two-component system response regulator VFG1389 Protein 2e-31 42