Gene Information

Name : LSA0077 (LSA0077)
Accession : YP_394688.1
Strain : Lactobacillus sakei 23K
Genome accession: NC_007576
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 72438 - 73151 bp
Length : 714 bp
Strand : +
Note : -

DNA sequence :
ATGGCTAAAAAAATATTGGTAGTTGATGATGAAAAACCCATCTCGGATATCGTTAAGTTTAATCTAACGAAAGAGGGCTA
TGATGTTTACACAGCTTATGATGGGGAAGAAGCACTACAACAAGTAGAAGAAGTTGTCCCTGACTTAATTCTATTAGATT
TGATGTTACCTAAGGTTGACGGTCTTGAAGTCGCTCGCCAGGTACGCAAATCACACGATATGCCAATTATTATGGTAACA
GCTAAAGATTCAGAAATTGATAAAGTGATTGGGCTAGAATTAGGCGCTGATGATTATGTCACAAAACCTTTTTCCAATCG
TGAATTGGTTGCCCGTGTTAAAGCAAATTTAAGACGCCAAGGGTCAACCAGTCAATCTGATAAAGAAGCAAATGAGGAAA
ACCACGAAATTAACATTGGCGACCTCACGATTCACCCAGAAGCTTATATTGTGTCTAAACGGGGCACGAAGATTGAATTA
ACGCATCGTGAATTCGAATTATTACATTACTTAGCCAAACATATTGGGCAAGTAATGACGCGTGAACATTTATTACAAAC
AGTTTGGGGTTATGACTATTTTGGTGATGTGCGCACAGTAGATGTCACAGTCCGTCGTTTACGTGAGAAGATTGAAGATA
ATCCTAGTCATCCAGAATGGTTAGTAACGCGTCGTGGTGTTGGTTATTATTTAAGAAATCCTGAGCAGGAGTAA

Protein sequence :
MAKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVEEVVPDLILLDLMLPKVDGLEVARQVRKSHDMPIIMVT
AKDSEIDKVIGLELGADDYVTKPFSNRELVARVKANLRRQGSTSQSDKEANEENHEINIGDLTIHPEAYIVSKRGTKIEL
THREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPEWLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSA0077 YP_394688.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-70 71
LSA0077 YP_394688.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-53 54
LSA0077 YP_394688.1 two-component system response regulator NC_007793.3914279.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_002745.1124361.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_009782.5559369.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_002951.3237708.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_002758.1121668.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_009641.5332272.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator NC_013450.8614421.p0 Protein 4e-53 53
LSA0077 YP_394688.1 two-component system response regulator HE999704.1.gene2815. Protein 9e-47 52
LSA0077 YP_394688.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-42 49
LSA0077 YP_394688.1 two-component system response regulator AE016830.1.gene1681. Protein 4e-44 46
LSA0077 YP_394688.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-37 45
LSA0077 YP_394688.1 two-component system response regulator AF162694.1.orf4.gene Protein 4e-36 44
LSA0077 YP_394688.1 two-component system response regulator FJ349556.1.orf0.gene Protein 5e-38 44
LSA0077 YP_394688.1 two-component system response regulator HE999704.1.gene1528. Protein 3e-29 43
LSA0077 YP_394688.1 two-component system response regulator AF130997.1.orf0.gene Protein 4e-37 43
LSA0077 YP_394688.1 two-component system response regulator AM180355.1.gene1830. Protein 2e-38 43
LSA0077 YP_394688.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-36 43
LSA0077 YP_394688.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-31 43
LSA0077 YP_394688.1 two-component system response regulator BAC0039 Protein 1e-31 43
LSA0077 YP_394688.1 two-component system response regulator CP000034.1.gene2186. Protein 1e-31 43
LSA0077 YP_394688.1 two-component system response regulator CP000034.1.gene3834. Protein 5e-32 42
LSA0077 YP_394688.1 two-component system response regulator NC_002695.1.915041.p Protein 5e-32 42
LSA0077 YP_394688.1 two-component system response regulator CP001918.1.gene5135. Protein 2e-28 42
LSA0077 YP_394688.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-34 42
LSA0077 YP_394688.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-29 42
LSA0077 YP_394688.1 two-component system response regulator CP000647.1.gene2531. Protein 2e-29 42
LSA0077 YP_394688.1 two-component system response regulator CP001138.1.gene2239. Protein 4e-30 42
LSA0077 YP_394688.1 two-component system response regulator BAC0596 Protein 4e-30 42
LSA0077 YP_394688.1 two-component system response regulator EU250284.1.orf4.gene Protein 1e-34 41
LSA0077 YP_394688.1 two-component system response regulator CP000647.1.gene4257. Protein 4e-32 41
LSA0077 YP_394688.1 two-component system response regulator CP001138.1.gene4273. Protein 3e-32 41
LSA0077 YP_394688.1 two-component system response regulator BAC0533 Protein 4e-32 41
LSA0077 YP_394688.1 two-component system response regulator DQ212986.1.gene4.p01 Protein 4e-37 41
LSA0077 YP_394688.1 two-component system response regulator CP004022.1.gene3215. Protein 3e-35 41
LSA0077 YP_394688.1 two-component system response regulator CP001918.1.gene3444. Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSA0077 YP_394688.1 two-component system response regulator VFG1389 Protein 3e-31 45
LSA0077 YP_394688.1 two-component system response regulator VFG1702 Protein 4e-33 42
LSA0077 YP_394688.1 two-component system response regulator VFG1390 Protein 2e-34 41
LSA0077 YP_394688.1 two-component system response regulator VFG1563 Protein 7e-33 41
LSA0077 YP_394688.1 two-component system response regulator VFG1386 Protein 9e-34 41