Gene Information

Name : yeeU (SDY_1010)
Accession : YP_402666.1
Strain : Shigella dysenteriae Sd197
Genome accession: NC_007606
Putative virulence/resistance : Virulence
Product : structural protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 954447 - 954824 bp
Length : 378 bp
Strand : -
Note : -

DNA sequence :
GTGTCAGACACACTCCCCGGGACAACGCTTCCCGACGATAACAAAGACCGCCCCTGGTGGAGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCAGTTGCATTACCTTGCAGACCGCGCCGGTATCAGAGGCCGGT
TCAGCAATGCGGATGCATACCATCTGGACCAGGCTTTTCCACTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACACTGTATGCGAAAGGGCTGACCTGCGAAGCTGATACCCTTGGCAGTTG
TGGTTACGTTTATCTGGCTGTTTATCCGACACCGGCAGCACCCGCAATCACCGTATAA

Protein sequence :
MSDTLPGTTLPDDNKDRPWWRLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-52 95
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-52 95
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 8e-52 94
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 8e-52 94
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 3e-49 94
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 1e-51 93
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 1e-49 93
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-48 92
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 4e-49 91
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 6e-49 91
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 9e-48 90
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 2e-48 90
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 3e-46 89
Z1220 NP_286755.1 structural protein Not tested TAI Protein 8e-48 88
Z1658 NP_287161.1 structural protein Not tested TAI Protein 8e-48 88
unnamed AAL57576.1 unknown Not tested LEE Protein 5e-46 87
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 4e-48 86
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-48 86
unnamed AAL08477.1 unknown Not tested SRL Protein 2e-47 85

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeU YP_402666.1 structural protein VFG0662 Protein 2e-52 94
yeeU YP_402666.1 structural protein VFG1619 Protein 4e-50 93
yeeU YP_402666.1 structural protein VFG1681 Protein 4e-48 90
yeeU YP_402666.1 structural protein VFG1068 Protein 6e-48 85