Gene Information

Name : SBO_2715 (SBO_2715)
Accession : YP_409073.1
Strain : Shigella boydii Sb227
Genome accession: NC_007613
Putative virulence/resistance : Unknown
Product : protein encoded within IS
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2726702 - 2727052 bp
Length : 351 bp
Strand : +
Note : Code: L; COG: COG3436

DNA sequence :
ATGATCTCACTCCCGTCAGGCACCCGCATCTGGCTCGTTGCTGGGATAACCGATATGCGTAAGTCTTTCAACGGGCTGGG
TGAACAGGTACAGCATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTCATCTTCCGTGGCCGACGGGGTGACATGA
TTAAAATCCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAGACGCCTGGAGGAAGGCCAGTTTATCTGGCCTGCT
GTGCGTGACGGCAAGGTATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGCCTTAATGCACTGACAATGTTGTAA

Protein sequence :
MISLPSGTRIWLVAGITDMRKSFNGLGEQVQHVLNDNPFSGHLFIFRGRRGDMIKILWADADGLCLFTRRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-48 96
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-48 96
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-49 96
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-49 96
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-49 95
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-38 71
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-38 71
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-38 70
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-35 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-35 66
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-35 66
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-35 66
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-35 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-35 66
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-35 66
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-35 66
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-35 66
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-35 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-35 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-26 66
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-34 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-34 65
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-35 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-35 63
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-28 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBO_2715 YP_409073.1 protein encoded within IS VFG1737 Protein 1e-49 95
SBO_2715 YP_409073.1 protein encoded within IS VFG1665 Protein 1e-38 70
SBO_2715 YP_409073.1 protein encoded within IS VFG1052 Protein 8e-36 67
SBO_2715 YP_409073.1 protein encoded within IS VFG0792 Protein 1e-35 66
SBO_2715 YP_409073.1 protein encoded within IS VFG1698 Protein 2e-35 66
SBO_2715 YP_409073.1 protein encoded within IS VFG1709 Protein 1e-35 66
SBO_2715 YP_409073.1 protein encoded within IS VFG1517 Protein 4e-27 66