Gene Information

Name : amb1370 (amb1370)
Accession : YP_420733.1
Strain : Magnetospirillum magneticum AMB-1
Genome accession: NC_007626
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1486809 - 1487531 bp
Length : 723 bp
Strand : -
Note : consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACCGCCCGCGAGACCGCCAATCCTTCCAAGCCTCTTGTCCTGGTCGTCGAGGATGAAGCGGCGCTGGCCACCATGCT
GCGCTACAACCTGGAAAAGGAAGGCTACCGCGTCGCCGAGGCCGCCGACGGCGAGGAGGCGCTGACCGTGCTGGCCGAGC
GCAAGCCCGATCTGGTGCTGCTGGACTGGATGCTGCCCTCGCTGTCGGGCATCGAGATCTGCCGCCAGATCCGCCGCAAG
CCCGCCACCCGCGAACTGCCCATCATCATGCTGACCGCCCGGGGCGAGGAAGGCGACAAGATCCGAGGCCTGAACACCGG
CGCCGACGACTACCTGACCAAGCCGTTCTCGCTGCCCGAACTGATGGCCCGCGTCCGCGCCCTGCTGCGCCGCGCCCAGC
CGGTCAGCCAGAAGGGACAGATCAGCTGGGGCGACGTCTCCATGGATCTGGCCTCCCACCGGGTGGTGCGGGCCGGCAAG
GCCATCCATCTCGGCCCCACCGAGTTCCGCCTGCTGCAATTCTTCCTGCAGCATCCGGGAACGGTGTTCTCGCGCGAGGA
ACTGCTCGACGCCGTGTGGGGTCCCGACATCTATGTGGAGCCGCGCACGGTGGATGTGCACATCCGCCGCCTGCGCAAGG
CGCTGAACTGCGACACCGAGGCCGACATCATCCGCACCGTGCGGGCCGCCGGCTATGCGCTGGACAACGAGGACGCGGCT
TAG

Protein sequence :
MTARETANPSKPLVLVVEDEAALATMLRYNLEKEGYRVAEAADGEEALTVLAERKPDLVLLDWMLPSLSGIEICRQIRRK
PATRELPIIMLTARGEEGDKIRGLNTGADDYLTKPFSLPELMARVRALLRRAQPVSQKGQISWGDVSMDLASHRVVRAGK
AIHLGPTEFRLLQFFLQHPGTVFSREELLDAVWGPDIYVEPRTVDVHIRRLRKALNCDTEADIIRTVRAAGYALDNEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-32 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
amb1370 YP_420733.1 response regulator NC_002952.2859905.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_007793.3914279.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_003923.1003749.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_007622.3794472.p0 Protein 2e-36 43
amb1370 YP_420733.1 response regulator NC_002745.1124361.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_009782.5559369.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_002951.3237708.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_002758.1121668.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_009641.5332272.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator NC_013450.8614421.p0 Protein 3e-36 43
amb1370 YP_420733.1 response regulator HE999704.1.gene2815. Protein 1e-34 43
amb1370 YP_420733.1 response regulator NC_010400.5986590.p0 Protein 2e-31 42
amb1370 YP_420733.1 response regulator NC_011595.7057856.p0 Protein 3e-32 42
amb1370 YP_420733.1 response regulator NC_010410.6002989.p0 Protein 3e-32 42
amb1370 YP_420733.1 response regulator NC_002952.2859858.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_007622.3794948.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_003923.1003417.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_013450.8614146.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_002951.3238224.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_007793.3914065.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_002758.1121390.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_010079.5776364.p0 Protein 6e-31 41
amb1370 YP_420733.1 response regulator NC_012469.1.7685629. Protein 1e-32 41
amb1370 YP_420733.1 response regulator AE000516.2.gene3505. Protein 9e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
amb1370 YP_420733.1 response regulator VFG1702 Protein 8e-33 44
amb1370 YP_420733.1 response regulator VFG1563 Protein 3e-32 42
amb1370 YP_420733.1 response regulator VFG1390 Protein 2e-33 42