Gene Information

Name : Moth_1131 (Moth_1131)
Accession : YP_429988.1
Strain : Moorella thermoacetica ATCC 39073
Genome accession: NC_007644
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1159173 - 1159853 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
TTGCGAGCCCGTATCCTGGTTGTCGATGACGATGCCAAGATTACTTCTATGCTCAAACGCGCTCTGACCTACGAGGGCTA
TGATGTAGAAATAGCTGCCAATGGCCACCAGGCCCTGGCCCTGGCGGCCAATAATCCAGATTTAATTATCCTGGATATCA
TGTTACCCGGCATTGACGGCCTGGCTGTCTGCCGCCAGATACGGTCCAACAGCGATATCCCCATCTTGATGTTGACCGCC
CGGGACGATACCGCCGACCGGGTCCTCGGTTTGGATACCGGGGCTGATGACTATCTGGTCAAACCCTTTGCGCTGGAAGA
ATTACTGGCCCGGATCCGCGCCCTTTTAAGACGCCGATCCCGGGAAACAGAGGCAGAGGTGCTCCAATTCAGTGATCTGA
CCCTGAATACGTCCACCAGGGAGGGCTTTCGGGGCCAGCGCAGCTTTTCCCTGACGGCCAAGGAATATGAACTACTGCTT
TATTTCCTCCAGAACCCGCACCGGGTCCTCACCAGGGATGAACTCATGACCCGGATCTGGGGTTATGACTTCAGTGGTGA
ATCCAATGTCCTGGAGGTTTATATCGGTTACCTGCGGGCTAAACTAGAAGCCGGGGGCGAGCCTCGCCTTATCCAGACAG
TCCGGGGTGTGGGTTATGTCCTCAAGGAGCAGCAGCCATGA

Protein sequence :
MRARILVVDDDAKITSMLKRALTYEGYDVEIAANGHQALALAANNPDLIILDIMLPGIDGLAVCRQIRSNSDIPILMLTA
RDDTADRVLGLDTGADDYLVKPFALEELLARIRALLRRRSRETEAEVLQFSDLTLNTSTREGFRGQRSFSLTAKEYELLL
YFLQNPHRVLTRDELMTRIWGYDFSGESNVLEVYIGYLRAKLEAGGEPRLIQTVRGVGYVLKEQQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-24 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0125 Protein 1e-32 44
Moth_1131 YP_429988.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-36 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-37 44
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0111 Protein 2e-30 44
Moth_1131 YP_429988.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-32 43
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0083 Protein 8e-31 43
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0197 Protein 3e-30 43
Moth_1131 YP_429988.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-36 43
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0308 Protein 1e-27 42
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0487 Protein 2e-15 41
Moth_1131 YP_429988.1 two component transcriptional regulator AE016830.1.gene2255. Protein 5e-25 41
Moth_1131 YP_429988.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 5e-25 41
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0347 Protein 6e-26 41
Moth_1131 YP_429988.1 two component transcriptional regulator BAC0638 Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_1131 YP_429988.1 two component transcriptional regulator VFG1390 Protein 3e-49 56
Moth_1131 YP_429988.1 two component transcriptional regulator VFG0473 Protein 5e-18 43
Moth_1131 YP_429988.1 two component transcriptional regulator VFG1389 Protein 4e-33 43
Moth_1131 YP_429988.1 two component transcriptional regulator VFG0596 Protein 2e-26 41
Moth_1131 YP_429988.1 two component transcriptional regulator VFG1386 Protein 4e-37 41