Gene Information

Name : Moth_0827 (Moth_0827)
Accession : YP_429687.1
Strain : Moorella thermoacetica ATCC 39073
Genome accession: NC_007644
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 857522 - 858292 bp
Length : 771 bp
Strand : +
Note : -

DNA sequence :
ATGGACTTTCCTGGCCGGGTCATACCGTTGATCTTCCCCGGCACAGGGTTTATCTTTATTATAGATACATCAAGGGGGTA
TCCAGAAGTGGAACCGGTACGGGTGCTGGTGGCCGACGACGAAGCCGGGTTGCGCCAGCTAGTGCGCCTTTATTTAGAAA
AGGAAGGCATGATAGTTGGCGAGGCCGCCACGGGTCGCCAGACCCTGGAGAGGTTGCATCAGGATAAATACGATCTCCTC
ATCCTGGACCTGATGATGCCCGACGGTGACGGCTGGACGGTCTGCCGGGAAGTGCGCCGTGAAATGGACCTGCCTATCAT
TATGCTCACCGCAAGGGGCGAGGAAATGGATCGCCTGCTGGGGTTCGAGCTGGGGGCAGACGACTACGTTACCAAGCCCT
TCAGCCCCCGGGAACTGGTGGCCAGGGTCAAGGCCTTATTACGGCGGGCCCGGAACGAGCGGGCACGGGGGGAACGGTTA
CAGTTTCCCGGCCTAGTAATCGACATTCCCGCCCGGGAGGTTAAGGTCGACGGCCGCACCATAGGCAACCTGACGCCCAA
GGAGTTCGATCTCCTCCTTTTCCTGGCCCGCCACCCCGGGCAGGTCATGAGCCGGGAAAAGATTCTGGAAAAGGTCTGGG
GCTACGATTTTTACGGTGACCTGCGGACGGTAGATACCCATATCAAAAACTTGCGGGAAAAGCTGGGCCGGGAACACGCC
TGGATCGCCACCGTCTGGGGCGTAGGATACAAGTTTGAGGTGGGGTCATGA

Protein sequence :
MDFPGRVIPLIFPGTGFIFIIDTSRGYPEVEPVRVLVADDEAGLRQLVRLYLEKEGMIVGEAATGRQTLERLHQDKYDLL
ILDLMMPDGDGWTVCREVRREMDLPIIMLTARGEEMDRLLGFELGADDYVTKPFSPRELVARVKALLRRARNERARGERL
QFPGLVIDIPAREVKVDGRTIGNLTPKEFDLLLFLARHPGQVMSREKILEKVWGYDFYGDLRTVDTHIKNLREKLGREHA
WIATVWGVGYKFEVGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-30 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_0827 YP_429687.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-32 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-32 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 47
Moth_0827 YP_429687.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-31 46
Moth_0827 YP_429687.1 two component transcriptional regulator BAC0039 Protein 3e-28 45
Moth_0827 YP_429687.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-28 45
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-28 45
Moth_0827 YP_429687.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-34 45
Moth_0827 YP_429687.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-34 44
Moth_0827 YP_429687.1 two component transcriptional regulator CP001918.1.gene3444. Protein 8e-28 44
Moth_0827 YP_429687.1 two component transcriptional regulator CP001138.1.gene2239. Protein 3e-27 44
Moth_0827 YP_429687.1 two component transcriptional regulator BAC0596 Protein 3e-27 44
Moth_0827 YP_429687.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-36 43
Moth_0827 YP_429687.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-34 43
Moth_0827 YP_429687.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-27 43
Moth_0827 YP_429687.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-19 42
Moth_0827 YP_429687.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-32 42
Moth_0827 YP_429687.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-19 42
Moth_0827 YP_429687.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 42
Moth_0827 YP_429687.1 two component transcriptional regulator CP004022.1.gene1676. Protein 1e-26 42
Moth_0827 YP_429687.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-33 41
Moth_0827 YP_429687.1 two component transcriptional regulator CP004022.1.gene3215. Protein 2e-23 41
Moth_0827 YP_429687.1 two component transcriptional regulator CP001138.1.gene4273. Protein 8e-19 41
Moth_0827 YP_429687.1 two component transcriptional regulator BAC0533 Protein 3e-19 41
Moth_0827 YP_429687.1 two component transcriptional regulator CP000647.1.gene4257. Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_0827 YP_429687.1 two component transcriptional regulator VFG1563 Protein 7e-31 41
Moth_0827 YP_429687.1 two component transcriptional regulator VFG1702 Protein 5e-30 41