Gene Information

Name : BTH_I1448 (BTH_I1448)
Accession : YP_441994.1
Strain :
Genome accession: NC_007651
Putative virulence/resistance : Unknown
Product : TnpB protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1639848 - 1640195 bp
Length : 348 bp
Strand : +
Note : identified by match to protein family HMM PF05717

DNA sequence :
ATGATCGGGCTGCCCAGCCGCACAAAGGTCTGGCTGGCCGCGGGTGTGACTGATATGCGTTCAGGCTTCAACAGCTTGGC
CGCGAAGGTCCAGACCGTATTGGAACGCGATCCCTTCAGCGGCCACGTGTTCGTGTTCCGAGGCAAGCGCGGCGATCTGG
TCAAAGTGCTGTGGTGGAGCGGCGACGGCATGTGTCTTCTGATGAAACGCCTGGAACGGGGCCGATTCGTTTGGCCACGC
GCCGACGGTGGCGTTGTCTGCCTGAGCCAAGCCCAACTGTCGATGCTGCTCGAAGGTATCGACTGGCGCCAGCCGATACG
AACGACCGAGCCGACATCGGCGTTGTAA

Protein sequence :
MIGLPSRTKVWLAAGVTDMRSGFNSLAAKVQTVLERDPFSGHVFVFRGKRGDLVKVLWWSGDGMCLLMKRLERGRFVWPR
ADGGVVCLSQAQLSMLLEGIDWRQPIRTTEPTSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-38 76
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 8e-34 72
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-33 72
unnamed AAL99258.1 unknown Not tested LEE Protein 8e-34 72
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-33 72
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 8e-34 72
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-33 72
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-33 72
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-33 72
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-33 72
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-33 72
unnamed AAC31493.1 L0014 Not tested LEE Protein 8e-34 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-33 72
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-33 71
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-25 69
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-34 66
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-34 66
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-34 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-31 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-31 63
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-31 59
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-31 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-29 59
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-29 59
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-30 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTH_I1448 YP_441994.1 TnpB protein VFG1709 Protein 3e-34 72
BTH_I1448 YP_441994.1 TnpB protein VFG1698 Protein 7e-34 72
BTH_I1448 YP_441994.1 TnpB protein VFG0792 Protein 3e-34 72
BTH_I1448 YP_441994.1 TnpB protein VFG1052 Protein 7e-34 71
BTH_I1448 YP_441994.1 TnpB protein VFG1517 Protein 1e-25 69
BTH_I1448 YP_441994.1 TnpB protein VFG1665 Protein 3e-34 66
BTH_I1448 YP_441994.1 TnpB protein VFG1737 Protein 3e-31 57