|
Name : SG0681 (SG0681) Accession : YP_454361.1 Strain : Sodalis glossinidius morsitans Genome accession: NC_007712 Putative virulence/resistance : Virulence Product : hemolysin expression-modulating protein Function : - COG functional category : - COG ID : - EC number : - Position : 1154495 - 1154698 bp Length : 204 bp Strand : - Note : with Hns involved in transcriptional regulation of hemolysin; non-specific DNA-binding protein which affects the production of multiple proteins DNA sequence : ATGAAAAAGATCGACTATTTAATGCGCTTGAGGAAGTGCAGAACGCTGGAAACCCTTGAGCGTGTGATTGAAAAAAACAA ATATGAACTGTCCGATGACGAGCTAGAGATATTCAATTCCGCCGCCGATCATCGTCTGGCGGAACTGACGATGAACAAGC TATACGACAAAGTACCGGTTTCCGTCTGGAAGTATGTACGCTAA Protein sequence : MKKIDYLMRLRKCRTLETLERVIEKNKYELSDDELEIFNSAADHRLAELTMNKLYDKVPVSVWKYVR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | AAL08465.1 | putative transcriptional regulator | Not tested | SRL | Protein | 3e-10 | 64 |
| ECO103_3575 | YP_003223436.1 | regulator Hha-homolog | Not tested | LEE | Protein | 5e-04 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| SG0681 | YP_454361.1 | hemolysin expression-modulating protein | VFG1056 | Protein | 1e-10 | 64 |
