
|
Name : rpmF (ELI_08630) Accession : YP_458615.1 Strain : Erythrobacter litoralis HTCC2594 Genome accession: NC_007722 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L32 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0333 EC number : - Position : 1763406 - 1763585 bp Length : 180 bp Strand : - Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not DNA sequence : ATGGCTGTCCCTAAGAGAAAAGTATCGCCGCATCGCCGTGGCAACCGTCGTGCCCATGATTCGCTGAAGGTCGAGGCCTT CCACGAATGCAACAATTGCGGCGAATTGAAGCGTCCGCACAACATGTGCTCGCACTGCGGCTTCTACAACGGTCGCGAAG TCCTCGCTCCGAGCCTTTAA Protein sequence : MAVPKRKVSPHRRGNRRAHDSLKVEAFHECNNCGELKRPHNMCSHCGFYNGREVLAPSL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ef0104 | AAM75307.1 | EF0104 | Not tested | Not named | Protein | 0.006 | 41 |
| rpmF | NP_814351.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 0.009 | 41 |