Gene Information

Name : Adeh_4009 (Adeh_4009)
Accession : YP_467210.1
Strain : Anaeromyxobacter dehalogenans 2CP-C
Genome accession: NC_007760
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4620094 - 4620786 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
GTGACGTCCGTTCTCCTGGTGGACGACGAGCGCGACCTGCTCTCGCTCCTCGACTTCAACCTGCGCGCGTCCGGGTTCGA
GACGCTGCTCGCCACCACCGGCGAGCAGGCGCTCTCGCACCTCCGCCGCCGCGTGCCGGATCTGGTCCTGCTCGACGTGA
TGCTGCCCGACGTCTCGGGGACCGAGGTGTGCCGGCAGATCAAGTCCGACCCGCGCACCCGCCACGTCCCGGTGGTGATG
CTCACCGCCAAGGGGGACGAGGTGGACCGGGTGGTCGGCTTCGAGCTGGGCGCCGACGACTACGTGACGAAGCCGTTCAG
CGTGCGCGAGCTGGTGCTCCGGCTGAAGGCGGTGCTGCGCCGCTCCGCCGCCCGCCCCTCGGACCGCCCGCCCGAGTCGG
TGGGCCCCATCCGCGTGGACGTGGACGCCCACCGCGCCTACGTGGACGGCGCCGAGGTGGTGCTCACGCCGCTCGAGTTC
AAGCTGCTCACCACGCTCATGTCGCGGCTGGGCCGCGTGCAGTCGCGCGAGCAGCTCCTCGAGGACGTCTGGGAGATGTC
CTCCGAGGTCGAGACGCGCACGGTGGACACGCACGTGAAGCGGCTCCGTGAGAAGCTGGGGTCCGGACGCGACCTGCTGG
AGACGGTGCGGGGGATCGGCTATCGCCTCGTGGATCCGAGCGAGAGGCACTGA

Protein sequence :
MTSVLLVDDERDLLSLLDFNLRASGFETLLATTGEQALSHLRRRVPDLVLLDVMLPDVSGTEVCRQIKSDPRTRHVPVVM
LTAKGDEVDRVVGFELGADDYVTKPFSVRELVLRLKAVLRRSAARPSDRPPESVGPIRVDVDAHRAYVDGAEVVLTPLEF
KLLTTLMSRLGRVQSREQLLEDVWEMSSEVETRTVDTHVKRLREKLGSGRDLLETVRGIGYRLVDPSERH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 3e-21 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 3e-21 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 3e-21 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 3e-21 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 8e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 45
Adeh_4009 YP_467210.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-28 45
Adeh_4009 YP_467210.1 two component transcriptional regulator CP001138.1.gene4273. Protein 2e-24 43
Adeh_4009 YP_467210.1 two component transcriptional regulator BAC0533 Protein 5e-25 43
Adeh_4009 YP_467210.1 two component transcriptional regulator CP000647.1.gene4257. Protein 5e-25 43
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-28 43
Adeh_4009 YP_467210.1 two component transcriptional regulator CP000034.1.gene3834. Protein 4e-24 42
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002695.1.915041.p Protein 4e-24 42
Adeh_4009 YP_467210.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-24 42
Adeh_4009 YP_467210.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-27 42
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-27 42
Adeh_4009 YP_467210.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-26 42
Adeh_4009 YP_467210.1 two component transcriptional regulator BAC0039 Protein 2e-27 42
Adeh_4009 YP_467210.1 two component transcriptional regulator CP000647.1.gene2531. Protein 5e-26 42
Adeh_4009 YP_467210.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-31 41
Adeh_4009 YP_467210.1 two component transcriptional regulator BAC0596 Protein 6e-27 41
Adeh_4009 YP_467210.1 two component transcriptional regulator CP001138.1.gene2239. Protein 6e-27 41
Adeh_4009 YP_467210.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeh_4009 YP_467210.1 two component transcriptional regulator VFG1389 Protein 6e-23 42