Gene Information

Name : RHE_CH03257 (RHE_CH03257)
Accession : YP_470748.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Resistance
Product : methyl viologen/ethidium resistance transmembrane protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 3425453 - 3425794 bp
Length : 342 bp
Strand : -
Note : similar to emrE (SMc01523) [Sinorhizobium meliloti] and Atu2319 [Agrobacterium tumefaciens str. C58]; Similar to swissprot:Q92N24; location:bacterial inner membrane Psort-Score: 0.4715

DNA sequence :
ATGAGCCAGGCCGCCATTTACGGGCTGCTTTTTGCAGCCATCGTGCTCGAAGTCATCGGCACGACTGCGCTGCAATTGTC
GCAGCAGTTCACCCGCATGGGGCCGACGGCCCTTGTCGTCGCTTGCTATGCGGCGGCGTTTTACTGCCTGTCGCTGACGC
TGAAGAGCATTCCCGTTGGCATCGCCTATGCGATTTGGAGCGCTTTGGGGATCGTGCTGATTTCCTCGGTCGGCCTCGTC
TTCTTCAAGCAGCGCCTCGATCTGCCGGCGATCATCGGCCTCGGGCTGATCATATCCGGCGTCGTCGTCGTCAACCTGTT
CTCGAAAACCATTTCACATTGA

Protein sequence :
MSQAAIYGLLFAAIVLEVIGTTALQLSQQFTRMGPTALVVACYAAAFYCLSLTLKSIPVGIAYAIWSALGIVLISSVGLV
FFKQRLDLPAIIGLGLIISGVVVVNLFSKTISH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-16 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-16 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-16 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-16 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-15 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-16 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-16 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-15 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-16 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-16 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-15 54
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-16 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-15 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-16 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-15 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-16 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-16 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-16 54
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-16 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-16 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHE_CH03257 YP_470748.1 methyl viologen/ethidium resistance transmembrane protein CP001138.1.gene1489. Protein 3e-19 54
RHE_CH03257 YP_470748.1 methyl viologen/ethidium resistance transmembrane protein BAC0322 Protein 4e-16 54
RHE_CH03257 YP_470748.1 methyl viologen/ethidium resistance transmembrane protein BAC0323 Protein 4e-16 54
RHE_CH03257 YP_470748.1 methyl viologen/ethidium resistance transmembrane protein CP004022.1.gene1549. Protein 7e-13 51
RHE_CH03257 YP_470748.1 methyl viologen/ethidium resistance transmembrane protein BAC0140 Protein 8e-09 43