Gene Information

Name : ureB (RHE_CH03308)
Accession : YP_470799.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Virulence
Product : urease subunit beta
Function : -
COG functional category : E : Amino acid transport and metabolism
COG ID : COG0832
EC number : 3.5.1.5
Position : 3472196 - 3472501 bp
Length : 306 bp
Strand : -
Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym

DNA sequence :
ATGATTCCAGGCGAAATCATTGCCGCAAGCGGCGATATCGAACTCAACGCCGGCGCGCCGACGGTGACGCTGGAGGTTTC
CAACACGGGCGACCGGCCGGTGCAGGTGGGCAGCCACTATCATTTCGCCGAGACCAATGCCGGCCTCTCCTTCGATCGCG
CCGCCGCGCACGGCAAGCGGCTCGATATTCCCTCGGGAACGGCCGTGCGTTTCGAGCCGGGGCAGACGCGCTCGGTGACG
CTGATCCCGCTTTCCGGCAGGCGCGAGGTCTATGGCTTCCGCCAGCTGGTGATGGGCAAGCTTTAG

Protein sequence :
MIPGEIIAASGDIELNAGAPTVTLEVSNTGDRPVQVGSHYHFAETNAGLSFDRAAAHGKRLDIPSGTAVRFEPGQTRSVT
LIPLSGRREVYGFRQLVMGKL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureB YP_005684267.1 Urease beta subunit Not tested PiCp 7 Protein 3e-26 62
ureB YP_005686359.1 Urease beta subunit Not tested PiCp 7 Protein 3e-26 62
ureB YP_003784326.1 urease subunit beta Not tested PiCp 7 Protein 5e-26 62
ureB YP_005682175.1 Urease beta subunit Not tested PiCp 7 Protein 3e-26 62
ureB NP_286679.1 urease subunit beta Virulence TAI Protein 1e-24 62
ureB NP_287087.1 urease subunit beta Not tested TAI Protein 1e-24 62