Gene Information

Name : RHE_CH00774 (RHE_CH00774)
Accession : YP_468315.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Unknown
Product : insertion sequence transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 812948 - 813295 bp
Length : 348 bp
Strand : -
Note : similar to Y4hO [Rhizobium sp. NGR234] and yi06-II [Rhizobium etli]; Similar to entrez-protein:P50359; location:bacterial cytoplasm Psort-Score: 0.3010

DNA sequence :
ATGATCCCGGTTGCAAGTGGTGTGAAGGTCTGGCTGGCGACAGGCCATACGGACATGCGCAAAGGCTTCCCCGGTCTATC
GCTGATGGTGCAGGAGACGCTGAAGCGCGATCCGATGTGCGGACACCTGTTCGTATTCCGCGGTCGCGGTGGTGGCCTGA
TCAAGGTCATCTGGCATGACGGCCAGGGAGCCTGCCTGTTTACGAAGAAGCTTGAACGCGGACGCTTCGTCTGGCCGTCG
GCGACAGATGGATCGGTGGTGATCACACCGGCGCAGCTCGGTTATCTGCTGGAAGGTATAGACTGGCGGATGCCGCAAAA
AACCTGGCGACCGACGTCGGCAGGATGA

Protein sequence :
MIPVASGVKVWLATGHTDMRKGFPGLSLMVQETLKRDPMCGHLFVFRGRGGGLIKVIWHDGQGACLFTKKLERGRFVWPS
ATDGSVVITPAQLGYLLEGIDWRMPQKTWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-32 64
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-32 64
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-31 62
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-31 62
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-31 62
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-31 62
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-31 62
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-31 62
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-31 62
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-31 62
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-25 61
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-31 61
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-31 61
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-30 61
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-30 61
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-31 61
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-31 60
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-29 56
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-29 56
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-24 53
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-28 53
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-28 53
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-27 51
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-27 51
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-28 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1698 Protein 1e-32 64
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG0792 Protein 5e-32 62
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1709 Protein 5e-32 62
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1517 Protein 3e-25 61
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1052 Protein 9e-32 61
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1665 Protein 2e-31 60
RHE_CH00774 YP_468315.1 insertion sequence transposase VFG1737 Protein 1e-28 51