
|
Name : RHE_PA00083 (RHE_PA00083) Accession : YP_471674.1 Strain : Genome accession: NC_007762 Putative virulence/resistance : Unknown Product : insertion sequence transposase Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 91196 - 91543 bp Length : 348 bp Strand : + Note : Similar to hypothetical protein 20.3 K in IS1131 [Agrobacterium tumefaciens] and OrfB of ISRm15[Sinorhizobium meliloti]; Similar to entrez-protein:JC1151; location:bacterial cytoplasm Psort-Score: 0.0905 DNA sequence : ATGATCGGCCCATCGGGGAATGTGAGGGTCTATCTGGCCTGCGGAGTGACCGATATGCGGCGTGGCATTGATGGTCTGTC CGCGCTGGTCGAGACGGTCGTGAGGGAGGCACCGGGCTCGGGCGCAATCTTCGGCTTTCGCGGAAAACGCGCGGACCGGA TCAAGCTGCTTTGGTGGGATGGCCAGGGGTTCTGTCTGTTCTACAAGATTTTGGAGCGCGGATACTTTCCCTGGCCGACG GCGAAAGAGGGTGTAGCGCACCTGACGCAGGCGCAGCTTTCGATGCTCGTTGAGGGGATCGATTGGCGACGCCCGGCGTG GACTTCCGCTCCCGGCCGAACGGGATAA Protein sequence : MIGPSGNVRVYLACGVTDMRRGIDGLSALVETVVREAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPT AKEGVAHLTQAQLSMLVEGIDWRRPAWTSAPGRTG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 1e-20 | 54 |
| Z1132 | NP_286667.1 | hypothetical protein | Not tested | TAI | Protein | 1e-23 | 52 |
| unnamed | AAL08461.1 | unknown | Not tested | SRL | Protein | 2e-24 | 52 |
| Z1571 | NP_287075.1 | hypothetical protein | Not tested | TAI | Protein | 1e-23 | 52 |
| unnamed | AAC31493.1 | L0014 | Not tested | LEE | Protein | 1e-24 | 52 |
| hp4 | AAC61716.1 | Hp4 | Not tested | PAI I CFT073 | Protein | 1e-24 | 52 |
| unnamed | AAL99258.1 | unknown | Not tested | LEE | Protein | 1e-24 | 52 |
| c3578 | NP_755453.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 1e-24 | 52 |
| unnamed | ACU09438.1 | IS66 family element orf2 | Not tested | LEE | Protein | 1e-24 | 52 |
| Z4336 | NP_289561.1 | hypothetical protein | Not tested | OI-122 | Protein | 1e-24 | 52 |
| Z5097 | NP_290248.1 | prophage-associated protein | Not tested | LEE | Protein | 1e-24 | 52 |
| ECs4546 | NP_312573.1 | hypothetical protein | Not tested | LEE | Protein | 1e-24 | 52 |
| unnamed | ADD91739.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 4e-26 | 51 |
| aec52 | AAW51735.1 | Aec52 | Not tested | AGI-3 | Protein | 4e-26 | 51 |
| c3561 | NP_755436.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 4e-24 | 51 |
| ECUMN_3327 | YP_002414007.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 4e-24 | 51 |
| pB171ORF50 | CAD66190.1 | ORF50 protein of pB171 | Not tested | PAI III 536 | Protein | 8e-26 | 50 |
| ECO103_3553 | YP_003223420.1 | hypothetical protein | Not tested | LEE | Protein | 3e-23 | 50 |
| Z4316 | NP_289542.1 | hypothetical protein | Not tested | OI-122 | Protein | 3e-23 | 50 |
| Z1160 | NP_286695.1 | hypothetical protein | Not tested | TAI | Protein | 2e-22 | 48 |
| Z1599 | NP_287103.1 | hypothetical protein | Not tested | TAI | Protein | 2e-22 | 48 |
| l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 2e-16 | 47 |
| ECUMN_3364 | YP_002414037.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 3e-22 | 46 |
| ECO103_3567 | YP_003223430.1 | hypothetical protein | Not tested | LEE | Protein | 3e-21 | 45 |
| Z4338 | NP_289563.1 | hypothetical protein | Not tested | OI-122 | Protein | 3e-21 | 45 |
| Z1163 | NP_286698.1 | hypothetical protein | Not tested | TAI | Protein | 9e-12 | 41 |
| Z1602 | NP_287106.1 | hypothetical protein | Not tested | TAI | Protein | 9e-12 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1052 | Protein | 6e-25 | 52 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1709 | Protein | 4e-25 | 52 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG0792 | Protein | 4e-25 | 52 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1698 | Protein | 1e-24 | 51 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1665 | Protein | 3e-26 | 50 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1517 | Protein | 8e-17 | 47 |
| RHE_PA00083 | YP_471674.1 | insertion sequence transposase | VFG1737 | Protein | 9e-23 | 46 |