Gene Information

Name : CYB_2561 (CYB_2561)
Accession : YP_478755.1
Strain : Synechococcus sp. JA-2-3B'a(2-13)
Genome accession: NC_007776
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2664997 - 2665737 bp
Length : 741 bp
Strand : +
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
GTGGAAGCACAGCGTAAGGAACGGATTCTGGTGGTCGATGATGAGGCCAGCATTCGACGCATCTTGGAAACCCGTCTGTC
CATGATTGGATACGACGTGGTCACAGCTTCGGACGGCGAGGAGGCGCTGGAGGTTTTCCACAAGCAGGATCCCGACCTGG
TGGTGCTGGATGTGATGATGCCGAAGCTGGATGGCTATGGGGTCTGCCAGGAGCTGCGCAAAGAATCGGACATCCCCATC
ATCATGCTGACGGCGCTGGGAGATGTAGCCGACCGTATCACAGGGCTGGAGCTGGGGGCAGACGACTATGTGGTCAAGCC
CTTTTCGCCCAAGGAGCTGGAAGCTCGCATTCGGTCGGTGTTGCGCCGGGTGGCGCGGTCGGCCCACGATGGGATCCCCA
GTTCCGGGGTGATTCAAGTGGGGGACATCCGCATCGATACCAACAAGCGGCAGGTCTACAAACGGGACGAGCGCATTCGC
CTGACGGGGATGGAGTTTAGTCTGCTGGAGCTGCTGGTCAGTCGGTCGGGGGAGCCTTTTTCCCGCTCCGAGATTTTGCA
AGAGGTGTGGGGCTATACCCCGGAGCGCCATGTGGATACGCGGGTGGTGGATGTCCACATCTCGCGGCTGCGGGCCAAGC
TGGAGGATGACCCCAGCAACCCAGAGCTGATCCTGACGGCCCGAGGCACCGGCTATCTGTTTCAGCGCATCGTTCAGGGG
GAGGAACAGGCACGGTCTTGA

Protein sequence :
MEAQRKERILVVDDEASIRRILETRLSMIGYDVVTASDGEEALEVFHKQDPDLVVLDVMMPKLDGYGVCQELRKESDIPI
IMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVARSAHDGIPSSGVIQVGDIRIDTNKRQVYKRDERIR
LTGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRIVQG
EEQARS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 3e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 4e-48 49
CYB_2561 YP_478755.1 DNA-binding response regulator NC_012469.1.7685629. Protein 5e-44 46
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0125 Protein 1e-38 45
CYB_2561 YP_478755.1 DNA-binding response regulator AE000516.2.gene3505. Protein 3e-42 45
CYB_2561 YP_478755.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-42 45
CYB_2561 YP_478755.1 DNA-binding response regulator CP000034.1.gene3671. Protein 8e-39 43
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0308 Protein 3e-36 42
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0083 Protein 2e-35 42
CYB_2561 YP_478755.1 DNA-binding response regulator CP001918.1.gene5135. Protein 6e-26 42
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0197 Protein 1e-34 42
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0638 Protein 3e-28 42
CYB_2561 YP_478755.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 3e-36 41
CYB_2561 YP_478755.1 DNA-binding response regulator CP004022.1.gene3215. Protein 2e-34 41
CYB_2561 YP_478755.1 DNA-binding response regulator CP001138.1.gene4273. Protein 3e-29 41
CYB_2561 YP_478755.1 DNA-binding response regulator BAC0533 Protein 9e-30 41
CYB_2561 YP_478755.1 DNA-binding response regulator NC_002695.1.915041.p Protein 9e-29 41
CYB_2561 YP_478755.1 DNA-binding response regulator CP000647.1.gene4257. Protein 9e-30 41
CYB_2561 YP_478755.1 DNA-binding response regulator CP000034.1.gene3834. Protein 9e-29 41
CYB_2561 YP_478755.1 DNA-binding response regulator AE016830.1.gene1681. Protein 1e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYB_2561 YP_478755.1 DNA-binding response regulator VFG1390 Protein 2e-39 44
CYB_2561 YP_478755.1 DNA-binding response regulator VFG0596 Protein 2e-31 42
CYB_2561 YP_478755.1 DNA-binding response regulator VFG1389 Protein 7e-32 42