Gene Information

Name : Francci3_2401 (Francci3_2401)
Accession : YP_481497.1
Strain : Frankia sp. CcI3
Genome accession: NC_007777
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2780253 - 2781104 bp
Length : 852 bp
Strand : -
Note : -

DNA sequence :
ATGACCGAGTCCCGCGGCGCCACCGGCCGTGACACCGGCCGCAGACCGGAGCGGTTCTGCGCTCGCAGCAGCTCTACGAT
CCGTTCCATGCGGGTACTGGTCGTCGAGGACGAGGCGCGCACCGCCGCCCTGCTCCGCCGTGGCCTGGTCGAGGAGGGCT
ACGCGGTCGACGTCGTCGGTGACGGCGCCGACGCGGTCTGGCAGGCGACCGAGATCGGCTACGACGCGATCGTCCTGGAC
CTCATGCTTCCCGGTCTCGACGGATTCGAGGTGTGCCGCCGCCTGCGCGAGGCGGGCCGCTGGGCCCCGGTGCTCATGCT
CACCGCCCGGGGGGACGTTGACGACCGTATCCGCGGTCTCGACGCGGGTGCCGACGACTACCTGCCCAAGCCGTTCAGCT
TCGGGGAACTGACCGCCCGGCTGCGGGCGCTCGTGCGGCGCGGGGCCGTGGAACGCCCCACCGTCCTGCGGATCGGGGAT
CTTCGCCTCGACCCGGCCGAGCACCGCGTCCTGCGGGCTGGATCGCCACTCGACCTGTCCGCGAAGGAGTTCGCGCTCCT
CCACCTGCTCATGCGCCATCCCGACGAGGTTCTGACCCGTACCTATATCGTCGATCACGTCTGGGACTTCGCCTTCGACG
GCACCTCCAACATCGTCGACCAGTACGTGCGCTACGTCCGCCGGAAGATCGACATTCCGGACGGTCCGTCGCTCATCGAG
ACCGTCCGCGGGGTCGGATACCGGCTACGGACCCCGGCCGAGACGCCGCCCGGGAGGTCCCGCACACCTGATGTGTCTGC
CGCGCCCGGTGCGTCTGCCGCGCCCGGCCCGGTCGTCGACGGGGGATCGTAG

Protein sequence :
MTESRGATGRDTGRRPERFCARSSSTIRSMRVLVVEDEARTAALLRRGLVEEGYAVDVVGDGADAVWQATEIGYDAIVLD
LMLPGLDGFEVCRRLREAGRWAPVLMLTARGDVDDRIRGLDAGADDYLPKPFSFGELTARLRALVRRGAVERPTVLRIGD
LRLDPAEHRVLRAGSPLDLSAKEFALLHLLMRHPDEVLTRTYIVDHVWDFAFDGTSNIVDQYVRYVRRKIDIPDGPSLIE
TVRGVGYRLRTPAETPPGRSRTPDVSAAPGASAAPGPVVDGGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-31 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0197 Protein 8e-39 51
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0083 Protein 9e-38 50
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0125 Protein 2e-38 50
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0308 Protein 7e-33 47
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0638 Protein 1e-29 45
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0111 Protein 1e-35 45
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0347 Protein 2e-31 42
Francci3_2401 YP_481497.1 two component transcriptional regulator BAC0288 Protein 4e-26 42
Francci3_2401 YP_481497.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 5e-19 42
Francci3_2401 YP_481497.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-19 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-26 41
Francci3_2401 YP_481497.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Francci3_2401 YP_481497.1 two component transcriptional regulator VFG1390 Protein 1e-36 48
Francci3_2401 YP_481497.1 two component transcriptional regulator VFG0596 Protein 3e-31 47
Francci3_2401 YP_481497.1 two component transcriptional regulator VFG1386 Protein 2e-33 45