Gene Information

Name : RPB_0781 (RPB_0781)
Accession : YP_484403.1
Strain : Rhodopseudomonas palustris HaA2
Genome accession: NC_007778
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 874529 - 875230 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGCGCGCATTCTGGTGGTTGAAGACGAGGAAGCGCTGACCACGCTGCTGCGATACAATCTCGAATCCGACGGCTA
CGACGTCGAAACCGTCGCCCGCGGCGACGATGCCGACACACGGATGAAGGAGCGGCTGCCGGATCTGGTGGTGCTGGACT
GGATGCTGCCGGGTCTCTCCGGCATCGAACTGTGCCGCCGGCTGCGGGCGCGGACCGACACCAAGCAGTTGCCGATCATC
ATGTTGACCGCGCGCGGCGAGGAGAGCGAACGCGTCCGCGGCCTCGCCACCGGCGCCGACGACTACATCGTCAAGCCGTT
CTCGGTGCCGGAACTGCTGGCGCGGGTGAAGGGTCTGCTGCGTCGCGCCGCACCCGAGCGGCTCGCCACCGTGCTGACCT
ATGGCGATCTCGAACTCGACCGCGACAAGCGCCGCGTCGCGCGCAGCGGCCGGCCGATCGATCTCGGCCCGACCGAATAT
CGCCTGCTCGAATTCTTCCTGGAGCATCCCGGCCGGGTGTTCAGCCGCGAGCAACTGCTCGACGGCGTCTGGGGCCGCGA
CATCTACATCGACGAGCGCACCGTCGACGTCCACATCGGCCGTCTGCGCAAGCTGCTCAATCCGGGCCGCGAGCAGGACC
CGATCCGCACCGTGCGCGGCGCCGGCTACGCGCTCGACGATCGCTTCGCCAAGGTGGAGTAA

Protein sequence :
MGARILVVEDEEALTTLLRYNLESDGYDVETVARGDDADTRMKERLPDLVVLDWMLPGLSGIELCRRLRARTDTKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRAAPERLATVLTYGDLELDRDKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERTVDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAKVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPB_0781 YP_484403.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-35 44
RPB_0781 YP_484403.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-37 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-37 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-42 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-42 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 43
RPB_0781 YP_484403.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator BAC0039 Protein 2e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator BAC0596 Protein 2e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-34 43
RPB_0781 YP_484403.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-36 42
RPB_0781 YP_484403.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-38 42
RPB_0781 YP_484403.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 42
RPB_0781 YP_484403.1 two component transcriptional regulator HE999704.1.gene1528. Protein 5e-31 41
RPB_0781 YP_484403.1 two component transcriptional regulator BAC0083 Protein 3e-35 41
RPB_0781 YP_484403.1 two component transcriptional regulator BAC0111 Protein 4e-34 41
RPB_0781 YP_484403.1 two component transcriptional regulator NC_008702.1.4607594. Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPB_0781 YP_484403.1 two component transcriptional regulator VFG1390 Protein 4e-39 45
RPB_0781 YP_484403.1 two component transcriptional regulator VFG1563 Protein 8e-35 43
RPB_0781 YP_484403.1 two component transcriptional regulator VFG1702 Protein 4e-35 43
RPB_0781 YP_484403.1 two component transcriptional regulator VFG1389 Protein 2e-30 42