Gene Information

Name : yeeV (Y75_p1966)
Accession : YP_490246.1
Strain : Escherichia coli K-12
Genome accession: NC_007779
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2079706 - 2080080 bp
Length : 375 bp
Strand : +
Note : CP4-44 prophage region; ECK1998:JW1987:b2005

DNA sequence :
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCTCGCCCGTCTCCTGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTATGGCCTCACACTGAATGACACACCTTTTGCCGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGCGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGTATCCGGAGGCGAAATGA

Protein sequence :
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-47 91
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 2e-47 90
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-47 90
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 3e-47 90
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 4e-47 89
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 4e-47 89
unnamed AAC31486.1 L0007 Not tested LEE Protein 3e-47 89
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 3e-47 89
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 4e-46 89
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-46 88
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 8e-47 88
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 8e-47 88
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 3e-46 88
unnamed AAL57575.1 unknown Not tested LEE Protein 9e-46 88
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 6e-46 88
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-44 86
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 4e-44 86
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 4e-44 86
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-44 85
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 7e-44 85
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 7e-43 85
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 4e-44 84

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 9e-48 90
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 1e-47 89
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 2e-46 89
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 4e-47 88
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 1e-46 88
yeeV YP_490246.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 1e-44 86