Gene Information

Name : lpl3 (SAUSA300_0415)
Accession : YP_493128.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Virulence
Product : tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 467725 - 468516 bp
Length : 792 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGGAATATCTAAAAAGGCTTGCATTGTTAATAAGTGTTATTATTTTGACCATTTTTATAATGGGTTGTGATAGTCAAAG
CGATACTGCAGAAAATCCAAAAGAAGGTTCAAAAGAAGCACAAATTAAAAAGAGTTTTTCGAAAACGTTAGATATGTATC
CAATTAAGAATCTCGAGGATTTTTATGGCAAAGAAGGATATCGAGATGGCGAATTTAAAAAAGATGATAAAGGTACTTGG
CTAATTAGATCCGAAATAGTTAAACAGCCAAAGGGCAAAGTGATGAAAACAAGAGGTATGCAATTATATATTAATAGAAA
TACCGAAACAGCCAAAGGTTTCTTTGTTTTGAAAGAAATAAGTGAAAATAATAATCGTGTAAATAAAGATAAGGAGGAAA
AATACGAAGTGAAAATGGTAGGAAATAAAATTATTCCTACTGAACAAATTAATGACGAGAAAATAAAAAAAGAAATTGAA
AACTTCAAGTTTTTTGTGCAATATGGAAACTTTAAAAATTTCGAAAAATACAACAATGGTGAGTTTTCATATAATCCTGA
AGCACCAATTTATTCGGCTAAATATCAATTACACAACGATGATTACAATGTAAGGCAACTACGTAAAAGATATGACATTT
CAACAAAAGAAACACCGAAGTTACTTTTGAAAGGTGGAGGAGATTTAAAAAATTCCTCAGTTGGTCAAAACGATATTGAA
TTTACTTTTGTTGAAAGAAAAGGTGAGAATATTTATTTTAACGATAGTGTTGAATTCATACCAAGTAAGTAA

Protein sequence :
MEYLKRLALLISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKSFSKTLDMYPIKNLEDFYGKEGYRDGEFKKDDKGTW
LIRSEIVKQPKGKVMKTRGMQLYINRNTETAKGFFVLKEISENNNRVNKDKEEKYEVKMVGNKIIPTEQINDEKIKKEIE
NFKFFVQYGNFKNFEKYNNGEFSYNPEAPIYSAKYQLHNDDYNVRQLRKRYDISTKETPKLLLKGGGDLKNSSVGQNDIE
FTFVERKGENIYFNDSVEFIPSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 1e-101 100
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 3e-101 99
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 3e-101 99
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 1e-91 88
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 6e-67 67
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 6e-67 67
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-64 67
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 2e-69 66
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 8e-66 65
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 2e-59 64
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 2e-59 64
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 8e-56 64
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 3e-54 63
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 3e-54 63
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 3e-54 63
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 4e-50 62
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 2e-51 62
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 2e-51 62
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 1e-52 61
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 1e-52 61
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 1e-52 61
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 7e-55 60
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 8e-54 56
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 8e-54 56
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 4e-49 53
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 4e-49 53
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 2e-49 53
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 1e-47 53
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 2e-50 53
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 2e-48 53
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 2e-48 53
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 5e-51 52
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 5e-51 52
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 1e-46 52
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 6e-48 51
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 7e-45 51
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 4e-45 50
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-44 50
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 1e-44 50
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 1e-44 50
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 5e-40 50
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 2e-42 50
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 5e-42 50
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 5e-42 50
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 7e-39 49
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-43 49
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 5e-35 49
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 6e-43 49
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 6e-43 49
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 3e-38 48
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 2e-39 48
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 6e-42 48
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 3e-42 48
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 2e-34 48
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 2e-41 48
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 2e-34 48
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 2e-47 48
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 2e-41 48
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-47 48
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 1e-44 48
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 2e-41 48
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-37 48
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 8e-38 48
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 2e-44 48
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-43 48
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 4e-38 47
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 4e-38 47
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 2e-38 47
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 1e-40 47
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 1e-39 47
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 2e-44 47
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 3e-43 47
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 3e-43 47
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-38 47
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-43 47
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 8e-44 46
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 3e-35 45