Gene Information

Name : SAUSA300_0419 (SAUSA300_0419)
Accession : YP_493132.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Virulence
Product : tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 471340 - 472152 bp
Length : 813 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGGAGTATATAAAAAAAATTGCTTTGTACATGAGTGTATTACTTTTAATCATTTTTATTGGGGGATGTGGAAATATGAA
AGATGAACAGAAAAAAGAGGAACAAACGAATAAAACAGATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGCGAAAACGT
TAGATATGTATCCAATTAAGAATCTCGAGGATTTATACGACAAAGAAGGATATCGAGATGGTGAGTTTAAAAAAGGCGAT
AAAGGTACGTGGACTATACTTACAGGTTTTTCAAAAAGTAACAAACCAGGAGTATTAGATGATGAAGGCATGGTGTTATA
TCTTAATAGAAATGCCAAAAAGGCAACAGGTTATTATTTTGTAAATAAAGTTTATGATGATATTAGCAAAAATCATAATG
AGAAAAAATATCGTGTTGAACTAAAAAATAATAAGATTGTTCTTTTGGATAATGTAGAAGACAAAAAACTTAAACAAAAA
ATTGAAAATTTTAAATTTTTTAGTCAGTATGCTGATTTTAAAGATTTAAAAAATTATCAAGATGGAAATATAACAACTAA
TGAAAACGTACCGAGCTATGAAGCACAATATAAAATGAACAATAGTGATAAAAATGTAAAAAAACTTAGAGAAATTTATC
CAATTACAACTAATAACTCTCCAAATCTAAAATTATATATAGATGGTGATATAAAAGGAAGCTCAGTAGGATATAAAAAA
ATAGAATATAAATTTTCAAAAGATAAAGGTCAAGAGACAACATTAAGAGATTATTTGAATTTTGGACCGTCTGAAGGTGA
GAATGTTGAGTAG

Protein sequence :
MEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGD
KGTWTILTGFSKSNKPGVLDDEGMVLYLNRNAKKATGYYFVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQK
IENFKFFSQYADFKDLKNYQDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYKK
IEYKFSKDKGQETTLRDYLNFGPSEGENVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 2e-119 100
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 2e-119 99
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 3e-119 99
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 1e-99 83
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 1e-99 83
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 2e-98 82
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 2e-99 80
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 1e-92 74
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-85 71
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-85 71
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 8e-91 71
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 8e-91 71
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 1e-80 70
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 2e-87 70
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-76 70
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 5e-84 69
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 5e-84 69
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-88 69
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 1e-85 68
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 1e-73 67
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 2e-84 67
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 2e-84 67
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-84 67
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 5e-84 66
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 5e-84 66
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 5e-84 66
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-78 64
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 4e-78 63
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 3e-78 63
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-78 63
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 2e-78 63
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 7e-75 62
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 6e-74 61
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 6e-74 61
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 3e-74 61
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 7e-75 61
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 3e-74 61
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 1e-72 60
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 6e-73 60
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 4e-74 60
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 1e-78 60
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 1e-74 60
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-74 60
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 1e-74 60
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-74 60
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 1e-69 60
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 1e-69 60
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 8e-72 59
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 4e-70 59
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 7e-74 59
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 6e-74 59
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 3e-68 59
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 2e-71 58
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 3e-61 53
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 3e-61 53
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-58 53
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 1e-50 52
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 1e-50 52
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 8e-60 51
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 1e-57 51
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 1e-57 51
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 1e-54 51
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 1e-54 51
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 1e-54 51
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 7e-53 51
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 2e-51 51
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 4e-51 49
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 4e-59 49
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 9e-56 48
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 9e-56 48
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 6e-56 48
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 4e-50 48
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 4e-50 48
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 4e-50 48
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 2e-55 47
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 5e-48 47
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 5e-48 47