Gene Information

Name : Saro_2281 (Saro_2281)
Accession : YP_497552.1
Strain : Novosphingobium aromaticivorans DSM 12444
Genome accession: NC_007794
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2422368 - 2423057 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
GTGCCTGCTCCCAAGCTGCTGCTGGTTGAAGACGACACGGCGCTTGCCGAACTGGTGGAATACCGGTTCCGCGGTGAAGG
TTACGACGTTCGCACCACCGACGACGGCGATGAAGCGCTGTTGCTTGCGGCCGAGGATACACCGGATCTGGTCCTGCTGG
ACTGGATGATCGGCGGAACCAGCGGGATCGAGGTCTGCCGCCGCCTGCGCCGGAACAAGGAAACCGCGCACGTCCCGATC
ATCATGCTCACCGCGCGCAGCGACGAGGACGACCGCATCCGCGGCCTCGAAATCGGCGCCGACGATTACGTGACCAAGCC
CTTCTCCCCGCGTGAGCTGATCGCCCGCGTCGGCGCAGTCCTGCGCCGGGTGCGCCCGGCGCTGGCGGGCGAGACGATTA
CCGTCGGCGACCTGTCGCTCGATCCCACCGCGCACCGCGTTTCGCGGCGCGGACAGCCGATGAAGGTCGGCCCCACCGAA
TTCCGCCTGCTCAAGCATTTCATGGAGCACCCCGGCCGGGTCTTCTCGCGCGGGCAACTGCTCGACGCGGTGTGGGGTAG
CGGCAGCGACATCGAACTGCGCACGGTGGACGTCCACATCCGCCGCCTTCGCCAGGCCATTGCCGTTCCGGGTGCCGCCG
ATCCGGTGCGGACGGTACGCTCTGCCGGATACGCGCTCGAAGGCGTCTGA

Protein sequence :
MPAPKLLLVEDDTALAELVEYRFRGEGYDVRTTDDGDEALLLAAEDTPDLVLLDWMIGGTSGIEVCRRLRRNKETAHVPI
IMLTARSDEDDRIRGLEIGADDYVTKPFSPRELIARVGAVLRRVRPALAGETITVGDLSLDPTAHRVSRRGQPMKVGPTE
FRLLKHFMEHPGRVFSRGQLLDAVWGSGSDIELRTVDVHIRRLRQAIAVPGAADPVRTVRSAGYALEGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_2281 YP_497552.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-42 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-41 42
Saro_2281 YP_497552.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-37 42
Saro_2281 YP_497552.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-38 41
Saro_2281 YP_497552.1 two component transcriptional regulator BAC0039 Protein 2e-38 41
Saro_2281 YP_497552.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-38 41
Saro_2281 YP_497552.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_2281 YP_497552.1 two component transcriptional regulator VFG1702 Protein 2e-34 43
Saro_2281 YP_497552.1 two component transcriptional regulator VFG1563 Protein 4e-34 42
Saro_2281 YP_497552.1 two component transcriptional regulator VFG1389 Protein 1e-27 42