Gene Information

Name : DSY1381 (DSY1381)
Accession : YP_517614.1
Strain : Desulfitobacterium hafniense Y51
Genome accession: NC_007907
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG1476
EC number : -
Position : 1619190 - 1619357 bp
Length : 168 bp
Strand : -
Note : similarity to COG1476 Predicted transcriptional regulators

DNA sequence :
ATGTCCCAGGAACAATTGGCCATAGCCGTGGGGGTAACGCGCCAGACCATCGGCATGATTGAAGCAGGTAAATTCAACCC
ATCTTTGCAGTTATGCATAGCCATTTGTAAAGCGCTTGGCAAAACCTTAAATGACCTTTTTTGGGAGGATGATAAAAATG
AAAGATGA

Protein sequence :
MSQEQLAIAVGVTRQTIGMIEAGKFNPSLQLCIAICKALGKTLNDLFWEDDKNER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EF0524 NP_814301.1 Cro/CI family transcriptional regulator Not tested Not named Protein 1e-05 47
ef0042 AAM75247.1 EF0042 Virulence Not named Protein 8e-06 47
SH2314 YP_254229.1 hypothetical protein Not tested ¥ðSh1 Protein 1e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY1381 YP_517614.1 hypothetical protein VFG2175 Protein 3e-06 47
DSY1381 YP_517614.1 hypothetical protein VFG2168 Protein 3e-06 47