Gene Information

Name : DSY3998 (DSY3998)
Accession : YP_520231.1
Strain : Desulfitobacterium hafniense Y51
Genome accession: NC_007907
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4567640 - 4568332 bp
Length : 693 bp
Strand : +
Note : similarity to COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain(Evalue: 4E-55)

DNA sequence :
ATGCGAATTCTCTTAGTTGATGATGAAAAAAATATCAGCAATGTCCTGAAAGCGTATTTACAGCAAGAAGGGTTTCATGT
GACCACAGCGGTCAATGGCCTCGTAGCCTTGACCTTATTTAAAGAGAACTCCTACGATCTCGTCCTTCTCGATCTTATGC
TGCCAGGTTTATCCGGTGAGGAGATCTGTAGAGAGATTCGTAAAATCTCGGCCACTCCCGTTATTATGCTCACAGCCAAG
GTCGAGCTGGAGGATCGGCTGCAAGGCCTTAACTTGGGTGCCGATGACTATATCGGCAAACCTTTCAGTCCCCGGGAAGT
GGTGGCCCGGATCAAAGCCGTGCTTAGGCGAACCCATATTGAGACCTCTCTCCTTGCCGACAGCATCACTTACGATAACG
GTTTGACCATTGATAACGCACAGCACGAAGTCCGTTTACAGGAAGAGGTTATCTCCCTTACCCCCACTGAGTTCAAAATT
CTTGGTGCTTTAGCCAAGTATCCGGGGCGAGTGTATTCCCGGGGGCAGTTGGTACAAATCGTCCAAGGCCATGATTTCGG
CGGGGATGAACGGGTAATCGATGCCCATATCAAAAAATTACGCCAGAAACTTGAGCGAGTACCCAGCGATCCTAAAATTA
TACTGACGGTCTATGGAGTCGGCTATAAATTCAATGCCCATAAGGAGGAGTAA

Protein sequence :
MRILLVDDEKNISNVLKAYLQQEGFHVTTAVNGLVALTLFKENSYDLVLLDLMLPGLSGEEICREIRKISATPVIMLTAK
VELEDRLQGLNLGADDYIGKPFSPREVVARIKAVLRRTHIETSLLADSITYDNGLTIDNAQHEVRLQEEVISLTPTEFKI
LGALAKYPGRVYSRGQLVQIVQGHDFGGDERVIDAHIKKLRQKLERVPSDPKIILTVYGVGYKFNAHKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY3998 YP_520231.1 hypothetical protein AE000516.2.gene3505. Protein 4e-30 46
DSY3998 YP_520231.1 hypothetical protein AF130997.1.orf0.gene Protein 3e-28 45
DSY3998 YP_520231.1 hypothetical protein EU250284.1.orf4.gene Protein 5e-30 45
DSY3998 YP_520231.1 hypothetical protein NC_009782.5559369.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_002951.3237708.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_003923.1003749.p0 Protein 1e-33 44
DSY3998 YP_520231.1 hypothetical protein NC_007622.3794472.p0 Protein 6e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_002758.1121668.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_009641.5332272.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_013450.8614421.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_007793.3914279.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_002952.2859905.p0 Protein 1e-33 44
DSY3998 YP_520231.1 hypothetical protein NC_002745.1124361.p0 Protein 8e-34 44
DSY3998 YP_520231.1 hypothetical protein NC_012469.1.7686381. Protein 4e-33 44
DSY3998 YP_520231.1 hypothetical protein CP000647.1.gene4257. Protein 2e-26 44
DSY3998 YP_520231.1 hypothetical protein BAC0533 Protein 2e-26 44
DSY3998 YP_520231.1 hypothetical protein CP004022.1.gene3215. Protein 7e-29 44
DSY3998 YP_520231.1 hypothetical protein NC_010410.6002989.p0 Protein 4e-38 43
DSY3998 YP_520231.1 hypothetical protein NC_010400.5986590.p0 Protein 2e-37 43
DSY3998 YP_520231.1 hypothetical protein NC_011595.7057856.p0 Protein 4e-38 43
DSY3998 YP_520231.1 hypothetical protein DQ212986.1.gene4.p01 Protein 2e-31 43
DSY3998 YP_520231.1 hypothetical protein HE999704.1.gene2815. Protein 2e-32 43
DSY3998 YP_520231.1 hypothetical protein NC_002695.1.915041.p Protein 1e-25 43
DSY3998 YP_520231.1 hypothetical protein CP000034.1.gene3834. Protein 1e-25 43
DSY3998 YP_520231.1 hypothetical protein CP001138.1.gene4273. Protein 1e-25 43
DSY3998 YP_520231.1 hypothetical protein NC_012469.1.7685629. Protein 1e-29 43
DSY3998 YP_520231.1 hypothetical protein AM180355.1.gene1830. Protein 4e-31 43
DSY3998 YP_520231.1 hypothetical protein CP001918.1.gene3444. Protein 1e-38 43
DSY3998 YP_520231.1 hypothetical protein BAC0039 Protein 6e-39 43
DSY3998 YP_520231.1 hypothetical protein NC_002695.1.916589.p Protein 4e-39 43
DSY3998 YP_520231.1 hypothetical protein BAC0596 Protein 8e-38 43
DSY3998 YP_520231.1 hypothetical protein CP000034.1.gene2186. Protein 6e-39 43
DSY3998 YP_520231.1 hypothetical protein CP000647.1.gene2531. Protein 4e-39 43
DSY3998 YP_520231.1 hypothetical protein CP001138.1.gene2239. Protein 8e-38 43
DSY3998 YP_520231.1 hypothetical protein CP001918.1.gene5135. Protein 5e-22 43
DSY3998 YP_520231.1 hypothetical protein AF162694.1.orf4.gene Protein 7e-29 42
DSY3998 YP_520231.1 hypothetical protein CP004022.1.gene1676. Protein 6e-35 42
DSY3998 YP_520231.1 hypothetical protein NC_002758.1121390.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_010079.5776364.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_002952.2859858.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_007622.3794948.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_003923.1003417.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_013450.8614146.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_002951.3238224.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein NC_007793.3914065.p0 Protein 3e-23 41
DSY3998 YP_520231.1 hypothetical protein AE015929.1.gene1106. Protein 4e-20 41
DSY3998 YP_520231.1 hypothetical protein AE016830.1.gene1681. Protein 6e-31 41
DSY3998 YP_520231.1 hypothetical protein NC_005054.2598277.p0 Protein 5e-29 41
DSY3998 YP_520231.1 hypothetical protein NC_014475.1.orf0.gen Protein 5e-29 41
DSY3998 YP_520231.1 hypothetical protein CP000034.1.gene3671. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY3998 YP_520231.1 hypothetical protein VFG1563 Protein 8e-37 41