Gene Information

Name : Rfer_0422 (Rfer_0422)
Accession : YP_521707.1
Strain : Rhodoferax ferrireducens T118
Genome accession: NC_007908
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 430626 - 431309 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTCTCATCGTCGAAGACGAACCAAAAACGGGCGACTACCTCAAACAAGGTTTGGGCGAGGCTGGCTTTGTGGT
GGATTTGCTGCGAGATGGCACCGACGGCCTGCATCACGCGCTCACAGAAGACTACGATCTGGCGATTCTCGATGTGATGC
TGCCTGGCATGGACGGTTGGGCGGTTCTGGCCGGTATCCGCAAAGCGGGCAAGGACATGCCGGTGCTGTTTCTGAGCGCG
CGCGACCATGTTGATGACCGCGTCAAGGGCCTGGAGCTGGGCGCGGACGACTACCTGGTCAAACCATTTGCCTTTTCTGA
ATTACTGGCCCGCGTGCGCACGCTCTTGCGCCGGGGCGGCAAAGGTTCGTCCACGGAGTTTTTGCGCGCTGCCGACCTGG
AGCTTGACTTGCTGCGCCGCCGGGTCACCCGCGCCGGCAAACGCATTGATCTGACTTCCAAAGAATTTGCCCTGCTGGAG
TTGTTGCTGCGCCGCCAGGACGAAGTGCTGCCTCGCTCACTGATCGCGTCCCAGGTGTGGGACATGAATTTCGATTCCGA
CACCAATGTGATCGAGGTTGCCATGCGACGCCTGCGCGCCAAGGTGGACGACAATTTTGAACCCAAACTGATTCGTACCG
TGCGCGGCATGGGCTACGTGCTGGAGAGTCCCGCTTGCGCTTGA

Protein sequence :
MKILIVEDEPKTGDYLKQGLGEAGFVVDLLRDGTDGLHHALTEDYDLAILDVMLPGMDGWAVLAGIRKAGKDMPVLFLSA
RDHVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGGKGSSTEFLRAADLELDLLRRRVTRAGKRIDLTSKEFALLE
LLLRRQDEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRAKVDDNFEPKLIRTVRGMGYVLESPACA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-55 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-54 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0083 Protein 7e-68 72
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-66 72
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-67 67
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-64 67
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-65 64
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-62 63
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-59 61
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator BAC0487 Protein 5e-25 42
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 41
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator VFG0596 Protein 5e-56 58
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-39 46
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator VFG1386 Protein 9e-34 42
Rfer_0422 YP_521707.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-31 41