Gene Information

Name : Sde_3703 (Sde_3703)
Accession : YP_529170.1
Strain : Saccharophagus degradans 2-40
Genome accession: NC_007912
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4688076 - 4688774 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
ATGCAGAAGCGTATTTTGCTAATAGAAGATCACCAAGACATCAACGCATTAATTGCGATGAACTTGGAAGTATTAGATTA
CCACGTCACCCGCTGCAGCGACGGCGCGGAAGGCCTACACCTTGGCACCACTCAAACCTTCGATTTAATAATTTTAGATA
TTATGCTACCCAGCATGGATGGCCTACAGGTTTGCCAACATCTACGTGCCAAAAATATATTTACACCTATTCTTATGCTT
ACTGCTAAAAAATCCGAATCGGACCGCGTAGTAGGCTTAGAAACCGGTGCAGACGATTATCTTACCAAACCTTTTAGCGT
GCGCGAGCTACAAGCCCGCGTAAAAGCCCATTTGCGCCGCACCGATATGAGCCAAAAGGAAAGCACACCTCAAGCAGACG
ATGCGCTGCACTTTGGCGAGTTGTGTATAGATAAAACCAAACGCAGGTTAACCATTGGCGACAAAGAAATAACCCTTACC
GCAAAGGAATTTGATTTATTGCTATATATGGCCAGCCACCCGGGCCAAGTATTTAGCCGCGAAAAATTATTAGATGCCGT
ATGGGGTTATCAGCACAGCGGCTATGAGCACACGGTTAACTCTCACATTAACCGTTTGCGCACCAAACTAGAAACCGATA
CATCCAACCCTAAATACGTATTAACAGTATGGGGAGTAGGCTACAAGTTTTATGATTAA

Protein sequence :
MQKRILLIEDHQDINALIAMNLEVLDYHVTRCSDGAEGLHLGTTQTFDLIILDIMLPSMDGLQVCQHLRAKNIFTPILML
TAKKSESDRVVGLETGADDYLTKPFSVRELQARVKAHLRRTDMSQKESTPQADDALHFGELCIDKTKRRLTIGDKEITLT
AKEFDLLLYMASHPGQVFSREKLLDAVWGYQHSGYEHTVNSHINRLRTKLETDTSNPKYVLTVWGVGYKFYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-54 50
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-54 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-45 46
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-42 46
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 7e-49 45
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-43 45
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-47 45
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-45 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-48 44
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-40 43
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 3e-43 42
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-54 50
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-54 50
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-33 42
Sde_3703 YP_529170.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-33 41