Gene Information

Name : RPC_4918 (RPC_4918)
Accession : YP_534759.1
Strain : Rhodopseudomonas palustris BisB18
Genome accession: NC_007925
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5488465 - 5489169 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGAGTGCGCGCATTCTGGTAGTTGAAGACGAGGAAGCGCTGACGACGTTGCTGCGCTACAACCTCGACGCCGAAGGTTA
TGACGTCGAAACCGTAGCCCGCGGCGACGACGCCGACACCAGGCTGAAAGAACGGATTCCGGATCTGGTGGTGCTGGATT
GGATGCTGCCCGGGCTGTCGGGCATCGAATTGTGCCGGCGTTTGCGGGCGCGGCCGGAAACCAAGCAACTGCCGATCATC
ATGCTGACCGCGCGCGGCGAGGAAAGCGAGCGGGTGCGCGGGCTCGCCACCGGCGCCGACGACTACATCGTCAAGCCGTT
CTCAGTGCCGGAGTTGTTGGCCCGTGTGAAGGGCCTGTTGCGCCGCGCCAGTCCCGAGCGCCTCGCCACCGTGCTGGCCT
ATGGCGACATCGAGCTCGACCGCGACAAGCGCCGCGTCGCGCGCTCCGGACGGCCGATCGATTTGGGGCCGACCGAATAT
CGGCTGCTGGAGTTCTTTCTCGAGCATCCCGGCCGGGTGTTCAGCCGCGAACAATTGCTCGATAGCGTCTGGGGCCGCGA
CATCTACATCGACGAGCGTACCGTCGACGTGCATATCGGCCGCTTGCGCAAATTGCTCAATCCCGGCCGCGAGCAGGATC
CGATCCGCACCGTGCGCGGCGCCGGCTACGCGCTCGACGATCGCTTCGCCGCCAAGGCGGAGTGA

Protein sequence :
MSARILVVEDEEALTTLLRYNLDAEGYDVETVARGDDADTRLKERIPDLVVLDWMLPGLSGIELCRRLRARPETKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLATVLAYGDIELDRDKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAAKAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPC_4918 YP_534759.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 45
RPC_4918 YP_534759.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator BAC0596 Protein 1e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator BAC0039 Protein 2e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-34 43
RPC_4918 YP_534759.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-37 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 8e-38 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 8e-38 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-42 42
RPC_4918 YP_534759.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 42
RPC_4918 YP_534759.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-30 41
RPC_4918 YP_534759.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-38 41
RPC_4918 YP_534759.1 two component transcriptional regulator NC_008702.1.4607594. Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPC_4918 YP_534759.1 two component transcriptional regulator VFG1390 Protein 6e-39 45
RPC_4918 YP_534759.1 two component transcriptional regulator VFG1563 Protein 8e-35 44
RPC_4918 YP_534759.1 two component transcriptional regulator VFG1702 Protein 3e-35 44
RPC_4918 YP_534759.1 two component transcriptional regulator VFG1389 Protein 6e-30 41