Gene Information

Name : UTI89_C4976 (UTI89_C4976)
Accession : YP_543910.1
Strain : Escherichia coli UTI89
Genome accession: NC_007946
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4880212 - 4880538 bp
Length : 327 bp
Strand : -
Note : -

DNA sequence :
ATGACTAAAAAAACACGTTTTTCCCCCGAAGTCCGTCAACGGGCAGTTCGTATGGTTCTGGAAAGTCAGGGCGAATATGA
CTCACAATGGGCGGCAATTTGTTCCATTGCTCCAAAGACTGGCTGTACGCCGGAGACTCTGCGTGTCTGGGTTCGCCAGT
ATGAGCGGGATACCGGAGGCGGTGATGGTGGGCTTACCACCGCTGAACGTCAGCGTCTGAAAGAGCTGGAACGTGAAAAT
CGTGAACTGCGCCGCAGTAACAATATCCTTCGCCAGGCTTCCGCTTATTTTGCGAAGGCGGAGTTCGACCGCCTCTGGAA
AAAGTGA

Protein sequence :
MTKKTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKTGCTPETLRVWVRQYERDTGGGDGGLTTAERQRLKELEREN
RELRRSNNILRQASAYFAKAEFDRLWKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-26 100
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-25 99
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-25 99
unnamed AAF09023.1 unknown Not tested SHI-O Protein 6e-25 96
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 8e-26 96
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 6e-25 96
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 8e-26 96
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 8e-26 96
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 8e-26 96
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-24 95
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-24 95
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 2e-24 95
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 2e-24 95
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-24 95
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-24 95
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 3e-24 95
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 4e-24 95
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 3e-24 95
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 7e-25 95
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 3e-24 95
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 1e-24 95
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-24 95
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 2e-25 94
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-25 94
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-25 94
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 2e-25 94
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 8e-25 94
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 2e-25 94
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 2e-25 94
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 3e-25 94

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UTI89_C4976 YP_543910.1 hypothetical protein VFG1603 Protein 1e-26 100
UTI89_C4976 YP_543910.1 hypothetical protein VFG1717 Protein 1e-24 95
UTI89_C4976 YP_543910.1 hypothetical protein VFG0606 Protein 2e-25 95
UTI89_C4976 YP_543910.1 hypothetical protein VFG0643 Protein 6e-25 95