Gene Information

Name : Mfla_0489 (Mfla_0489)
Accession : YP_544600.1
Strain : Methylobacillus flagellatus KT
Genome accession: NC_007947
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 508369 - 509055 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGCCAGCGAATATTCTGGTTGTAGAAGACGAACCAGCCATCCAGGAATTGCTTGCGCTCAACTTGACGCAAGCAGGCCA
CAATCCCGTGCGCGCCCTGAGTGTGGAGCAAGCGCAAATGCTGATCCGCGAAGCCCTGCCAGACCTGATCCTGCTCGACT
GGATGCTGCCTGGCATGAGCGGCATCGAGTTTGCGCGCAAGCTGAAGAGCGACGAGCTCACCAAGGCCATCCCCATCATC
ATGCTGACCGCGCGTGGAGAGGAAGCCGACAAGGTACGCGGCCTGGAAGTCGGTGCAGATGACTATGTCACCAAGCCGTT
TAGCCCGAGGGAGCTCAATGCCCGCATCAAGGCAGTACTGCGTCGCCGCGCGCCACAAATGACCGATGACCCGCTCGAAA
TTGGCGGCCTGCGCCTGGATCCGATGACGCACCGCGTATCAGGCAACGGCAAGACATTGGAACTGGGGCCGACCGAATTC
CGCCTGCTGCACTACTTGATGTCCAACCCGGAACGCGTGCATTCCCGCACACAAGTGCTGGACCGTGTATGGGGAGACCG
CGTGTTCGTGGAAGACAGGACAGTGGATGTGCATATCCGCCGGCTGCGCCGCGCTCTTTCTGAATCAGGGCACGAGGAGT
TCATCCAGACAGTGCGTGGTGTCGGCTACCGTTTCTCCGCACAGTAG

Protein sequence :
MPANILVVEDEPAIQELLALNLTQAGHNPVRALSVEQAQMLIREALPDLILLDWMLPGMSGIEFARKLKSDELTKAIPII
MLTARGEEADKVRGLEVGADDYVTKPFSPRELNARIKAVLRRRAPQMTDDPLEIGGLRLDPMTHRVSGNGKTLELGPTEF
RLLHYLMSNPERVHSRTQVLDRVWGDRVFVEDRTVDVHIRRLRRALSESGHEEFIQTVRGVGYRFSAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mfla_0489 YP_544600.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-25 45
Mfla_0489 YP_544600.1 two component transcriptional regulator CP001138.1.gene4273. Protein 2e-25 45
Mfla_0489 YP_544600.1 two component transcriptional regulator CP000034.1.gene2186. Protein 5e-37 44
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-37 44
Mfla_0489 YP_544600.1 two component transcriptional regulator BAC0039 Protein 5e-37 44
Mfla_0489 YP_544600.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-39 44
Mfla_0489 YP_544600.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-25 44
Mfla_0489 YP_544600.1 two component transcriptional regulator BAC0533 Protein 2e-25 44
Mfla_0489 YP_544600.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-30 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-39 43
Mfla_0489 YP_544600.1 two component transcriptional regulator BAC0596 Protein 6e-37 43
Mfla_0489 YP_544600.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-37 43
Mfla_0489 YP_544600.1 two component transcriptional regulator CP001138.1.gene2239. Protein 6e-37 43
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-34 42
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-35 42
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-34 42
Mfla_0489 YP_544600.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-38 42
Mfla_0489 YP_544600.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 42
Mfla_0489 YP_544600.1 two component transcriptional regulator CP000647.1.gene2531. Protein 7e-37 42
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-36 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-37 41
Mfla_0489 YP_544600.1 two component transcriptional regulator CP000034.1.gene3834. Protein 7e-25 41
Mfla_0489 YP_544600.1 two component transcriptional regulator NC_002695.1.915041.p Protein 7e-25 41
Mfla_0489 YP_544600.1 two component transcriptional regulator CP004022.1.gene3215. Protein 8e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mfla_0489 YP_544600.1 two component transcriptional regulator VFG0596 Protein 2e-27 41