Gene Information

Name : Mfla_0883 (Mfla_0883)
Accession : YP_544992.1
Strain : Methylobacillus flagellatus KT
Genome accession: NC_007947
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 923184 - 923516 bp
Length : 333 bp
Strand : +
Note : -

DNA sequence :
ATGCAGCATTGGATATACTTGGGAATTGCCATCACGGCTGAAGTGGTGGCGACATCGGCGCTCAAGGCCAGCGACGGTTT
CACGCAATTATTGCCCAGCACGCTGGTGATCGTTGGCTATGCGACGGCATTTTATTTTCTCGCTTTGACGTTGCGCAGCA
TTCCGGTTGGAGTAGCCTATGCGGTCTGGTCGGGACTGGGCATTGTGCTGGTTTCAGTGATTGCCTCGTTGCTGTATGGA
CAGAAACTTGACTTGCCTGCAGTGATCGGGATGGCGTTGATCATCGCGGGCGTGGTGGTCATGCAGTTGTTTTCCAGGAC
AACAGGGCATTAA

Protein sequence :
MQHWIYLGIAITAEVVATSALKASDGFTQLLPSTLVIVGYATAFYFLALTLRSIPVGVAYAVWSGLGIVLVSVIASLLYG
QKLDLPAVIGMALIIAGVVVMQLFSRTTGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 65
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 65
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-26 65
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-26 65
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-26 65
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-26 65
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-26 65
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-26 65
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-26 65
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-26 65
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-26 65
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-26 65
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-26 65
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-26 65
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 65
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-26 65
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-26 65
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 65
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-26 65
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-26 65
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 3e-20 45
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 6e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0323 Protein 6e-27 65
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0322 Protein 5e-31 62
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0324 Protein 2e-30 60
Mfla_0883 YP_544992.1 small multidrug resistance protein CP004022.1.gene1549. Protein 9e-25 60
Mfla_0883 YP_544992.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-26 60
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0002 Protein 2e-26 60
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0377 Protein 5e-26 58
Mfla_0883 YP_544992.1 small multidrug resistance protein NC_002695.1.913273.p Protein 4e-23 58
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0150 Protein 6e-23 56
Mfla_0883 YP_544992.1 small multidrug resistance protein CP001138.1.gene1489. Protein 2e-25 56
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0139 Protein 2e-18 45
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0140 Protein 6e-18 45
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0192 Protein 3e-18 45
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0249 Protein 5e-09 45
Mfla_0883 YP_544992.1 small multidrug resistance protein AE000516.2.gene3301. Protein 5e-09 45
Mfla_0883 YP_544992.1 small multidrug resistance protein BAC0329 Protein 1e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mfla_0883 YP_544992.1 small multidrug resistance protein VFG1586 Protein 1e-20 45
Mfla_0883 YP_544992.1 small multidrug resistance protein VFG1587 Protein 2e-17 42