Gene Information

Name : Bpro_1956 (Bpro_1956)
Accession : YP_548785.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2022508 - 2023179 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCCTGTTACTGATCGAGGACGATGCCGCGCTGCGGCTCACACTGGCCCGCCAGCTGGAGGCCGATGGCTACCGGGT
CGACCAGGCCAAGGACGGCGAAGAGGGCCTGTTCCTGGCGCGCGAGTACCCGGTCGACCTGGTCATCGTCGACCTGGGGC
TGCCCAAGCTGAACGGGCTGACCATCGTGCAGCGCCTGCGCCAGGAGGGGCGTGCCATACCCATCCTGATCCTCACCGCA
CGCGGCAGCTGGCAAGACAAGGTTGTGGGGCTGGAGGCCGGGGCCGACGACTACCTGGTCAAGCCTTTCGAATACCCGGA
GCTGGCGGCGCGGCTCAAGGCCTTGTTGCGGCGCTCGCTCAAGACTGCCTCTGACGTGCTGACGCTCGGCCCCCTCAGCA
TTGACCTGTCGGCGCAGGCGGCGCGGCTCAATGGCGCGGCGTTGGAGCTCACGGCGTTCGAGTACCGCCTGCTCGAGTAT
CTGGTGCGCCAGCGCCCGGGCATCGTCACCAAGCAGGCGCTGTCGGACTACCTGTACCCGCACGGGGAAGACCGCGACAG
CAACGTGCTGGAGGTGCTGGTGGGTCGGCTGCGGCGCAAGCTCGACCCGGACGGCAGCCTCGGCCCGATCGAGACCGTGC
GAGGGCGTGGCTACCGGTTCACCCTGGAATGA

Protein sequence :
MRLLLIEDDAALRLTLARQLEADGYRVDQAKDGEEGLFLAREYPVDLVIVDLGLPKLNGLTIVQRLRQEGRAIPILILTA
RGSWQDKVVGLEAGADDYLVKPFEYPELAARLKALLRRSLKTASDVLTLGPLSIDLSAQAARLNGAALELTAFEYRLLEY
LVRQRPGIVTKQALSDYLYPHGEDRDSNVLEVLVGRLRRKLDPDGSLGPIETVRGRGYRFTLE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_1956 YP_548785.1 two component transcriptional regulator NC_002516.2.879194.p Protein 7e-51 54
Bpro_1956 YP_548785.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-39 47
Bpro_1956 YP_548785.1 two component transcriptional regulator CP001918.1.gene2526. Protein 9e-40 47
Bpro_1956 YP_548785.1 two component transcriptional regulator BAC0530 Protein 1e-39 47
Bpro_1956 YP_548785.1 two component transcriptional regulator NC_002695.1.913289.p Protein 6e-40 46
Bpro_1956 YP_548785.1 two component transcriptional regulator CP000034.1.gene2022. Protein 2e-40 46
Bpro_1956 YP_548785.1 two component transcriptional regulator CP004022.1.gene1005. Protein 2e-42 46
Bpro_1956 YP_548785.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-39 45
Bpro_1956 YP_548785.1 two component transcriptional regulator CP001485.1.gene721.p Protein 4e-21 41
Bpro_1956 YP_548785.1 two component transcriptional regulator BAC0638 Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_1956 YP_548785.1 two component transcriptional regulator VFG0475 Protein 2e-39 45
Bpro_1956 YP_548785.1 two component transcriptional regulator VFG0596 Protein 2e-20 41