Gene Information

Name : Bpro_2230 (Bpro_2230)
Accession : YP_549054.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2321111 - 2321386 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence :
GTGAAAAAACTGTTTGCCTCCCTCGCACTTGTCGCCGTCGTTGCCCCCGTGTTGGCCTCCACCCAGACCGTTACGCTGTC
GGTGCCGGGCATGACCTGCGCTGCCTGTCCAATCACTGTCAAAAAGGCCATCTCGAAAGTAGCGGGTGTAAGCAAGACCG
ACGTGAGTTTCGACAAGCGTGAGGCCGTCGTCACCTTCGACGATGCCAAAACCAGCGTCCAGAAGCTGACCAAGTCGACC
GAAGATGCGGGCTATCCGTCCAGCGTCAAGCGGTAA

Protein sequence :
MKKLFASLALVAVVAPVLASTQTVTLSVPGMTCAACPITVKKAISKVAGVSKTDVSFDKREAVVTFDDAKTSVQKLTKST
EDAGYPSSVKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 8e-25 89
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-24 89
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-24 85
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-24 85
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-23 85
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-24 85
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-24 85
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-24 85
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 7e-22 78
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-23 77

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_2230 YP_549054.1 mercuric transport protein periplasmic protein BAC0679 Protein 1e-24 90
Bpro_2230 YP_549054.1 mercuric transport protein periplasmic protein BAC0231 Protein 1e-24 88
Bpro_2230 YP_549054.1 mercuric transport protein periplasmic protein BAC0678 Protein 4e-24 86
Bpro_2230 YP_549054.1 mercuric transport protein periplasmic protein BAC0675 Protein 6e-21 72
Bpro_2230 YP_549054.1 mercuric transport protein periplasmic protein BAC0674 Protein 5e-17 60