Gene Information

Name : Bpro_0341 (Bpro_0341)
Accession : YP_547204.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Unknown
Product : IS66 Orf2 like protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 362591 - 362884 bp
Length : 294 bp
Strand : +
Note : -

DNA sequence :
ATGCGCTGCGGCTTTGACAGCCTGGCCGCCAGGATCCAGACCGCCCTGACCGAGAATCCCTTCTCGGGCCACATCTTTGT
CTACCGTGGCCGCCGCGGTGACCTCATCAAGCTGCTGTGGTGGGATGGCGACGGCCTGTGCCTGCTGGCCAAGCGCCTGG
AGCGCGGCCGCTTCATCTGGCCCCAGGCCGAATCCGGCGTGATCTCACTCACATCAGCCCAGCTGTCCATGCTGCTCGAA
GGCATCGACTGGCGCCGTCCCGAGCGCACCTGGGTGCCGCAGCGGGCCGTCTGA

Protein sequence :
MRCGFDSLAARIQTALTENPFSGHIFVYRGRRGDLIKLLWWDGDGLCLLAKRLERGRFIWPQAESGVISLTSAQLSMLLE
GIDWRRPERTWVPQRAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-23 71
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-19 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-19 67
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-19 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-19 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-19 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-19 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-19 67
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-19 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-19 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-19 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-19 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-19 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-19 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 7e-22 65
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 7e-22 65
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-11 64
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-21 64
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-21 64
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-21 64
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-17 58
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-17 57
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-17 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-16 55
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-16 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG0792 Protein 8e-20 67
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1052 Protein 2e-19 67
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1709 Protein 8e-20 67
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1698 Protein 6e-20 66
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1517 Protein 7e-12 64
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1665 Protein 2e-21 64
Bpro_0341 YP_547204.1 IS66 Orf2 like protein VFG1737 Protein 7e-18 58