Gene Information

Name : Bxe_A2502 (Bxe_A2502)
Accession : YP_558523.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Resistance
Product : quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2167673 - 2168011 bp
Length : 339 bp
Strand : +
Note : Citation: Paulsen,I.T., Littlejohn,T.G.,Radstrom,P., Sundstrom,L., Skold,O., Swedberg,G. andSkurray, R.A.Antimicrob. Agents Chemother. 37 (4), 761-768(1993)

DNA sequence :
ATGCGGTTGCCCGCTTACGCATTGCTAGGCATCGCCATCGTGGCCGAAGTGATTGCAACCTCCGCGATGCGCGCATCGGA
CGGTTTCTCGCGGATACTGCCTTCAGCGGTGGTGGTGCTCGGCTATGGCGTGGCGTTCTATTGCCTGTCGCTGACGCTCA
GGAGTATTCCGGTCGGCATCGTCTATGCGGTATGGTCCGGCGCCGGCATCGTGCTGATCACGCTGGTCGCGGTGGTGTTG
TACCGGCAGGTGCCCGACGTGCCGGCCATTATCGGCCTCGGGCTGATCATTGCCGGCGTCGCCGTGCTGAACATGTTCTC
GAAGATGCAGGCGCACTGA

Protein sequence :
MRLPAYALLGIAIVAEVIATSAMRASDGFSRILPSAVVVLGYGVAFYCLSLTLRSIPVGIVYAVWSGAGIVLITLVAVVL
YRQVPDVPAIIGLGLIIAGVAVLNMFSKMQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-17 60
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 60
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-17 60
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 60
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-17 60
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 60
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-17 60
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-17 60
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 60
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-17 60
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-17 60
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-17 60
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-17 60
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-17 60
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-17 60
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-17 60
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-17 60
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-17 60
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-17 60
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-17 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0322 Protein 1e-17 60
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0323 Protein 2e-17 60
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0377 Protein 2e-18 59
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0002 Protein 3e-17 59
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE NC_010410.6003348.p0 Protein 3e-17 59
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE CP001138.1.gene1489. Protein 4e-16 56
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0150 Protein 1e-11 47
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE NC_002695.1.913273.p Protein 1e-11 47
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0139 Protein 4e-14 46
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0477 Protein 5e-04 42
Bxe_A2502 YP_558523.1 quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE BAC0329 Protein 1e-13 42