Gene Information

Name : Bxe_A3777 (Bxe_A3777)
Accession : YP_557273.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 778096 - 778443 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATTGGTCCGCTCACAAACACGCGCATCTGGGTTGCCGCCGGATTTACGGATATGCGCTGCGGCTTCGACGGCCTGGC
CGCGAAGGTGCAGACCGTGCTGGCGAAGGATCCATTCTCTGGCCACATCTTCGTGTTCAGAGGCAAACGTGGCGACCTCA
TCAAGTGCCTGTACTGGCGCGACGGCGGCCTATGCCTGTTCGCCAAACGCCTGGAGCGTGGGCGCTTTGCGTGGCCTCGT
GCTGACGGCGGTGTTGTTTCGCTGACCAGCGCTCAACTCGGCCTCCTACTCGAAGGATTCGACTGGCGACAGCCCGTCGA
TGCAGCGCGCCCCTGCAGTGCTTTGTAA

Protein sequence :
MIGPLTNTRIWVAAGFTDMRCGFDGLAAKVQTVLAKDPFSGHIFVFRGKRGDLIKCLYWRDGGLCLFAKRLERGRFAWPR
ADGGVVSLTSAQLGLLLEGFDWRQPVDAARPCSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-43 83
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-26 66
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-26 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-27 65
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-27 65
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-27 65
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-27 65
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-27 65
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-27 65
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-27 65
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-27 65
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-27 65
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-27 65
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-27 65
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-20 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-30 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-30 63
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-30 61
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-30 61
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 9e-30 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-26 59
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-26 59
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-26 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-25 57
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-25 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A3777 YP_557273.1 transposase VFG1698 Protein 4e-28 65
Bxe_A3777 YP_557273.1 transposase VFG1052 Protein 9e-28 65
Bxe_A3777 YP_557273.1 transposase VFG1709 Protein 6e-28 65
Bxe_A3777 YP_557273.1 transposase VFG0792 Protein 6e-28 65
Bxe_A3777 YP_557273.1 transposase VFG1517 Protein 3e-20 63
Bxe_A3777 YP_557273.1 transposase VFG1665 Protein 4e-30 60
Bxe_A3777 YP_557273.1 transposase VFG1737 Protein 6e-27 57