Gene Information

Name : Bxe_B1389 (Bxe_B1389)
Accession : YP_553925.1
Strain :
Genome accession: NC_007952
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1837563 - 1838240 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGCGAATCCTGGTGATCGAGGACGAGCTGAAAACAGCGGCCTATCTGAAGAAAGGCCTGGAAGAATCCGGCTACGCGGT
CGACGTGGCGAACGACGGCCCTCAGGGGCTGATCCTCGCCCTCGAAGAAGAGTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGGCATGGACGGCTGGGGCGTCGTCAAGACCTTGCGCACCACGCGCACCACGCCCGTGCTGTTCCTCACCGCGCGC
GACGACGTGGACGACCGCGTACGCGGCCTCGAACTCGGCGCGGACGATTACCTCGTCAAACCCTTTGCGTTCGTCGAATT
GCTGGCCCGCGTGCGCACGCTGGCGCGCCGCGGGCCGCCGCGCGAAAGCGAACTCATCAAGGTAGGCGACCTGGAAATGG
ACGTGAACCGCCGGCGCGTGAAGCGCGGCGGTACGCGTATCGACCTCACGCCGCGTGAATTCTCGCTGCTGCAACTGCTC
GCGCGGCGTCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCGTCGTACGTGTGGGATATGAATTTCGACAGCGATACCAA
TGTGGTCGAAGTCGCGATCCGCCGCTTGCGCACCAAGATCGACGACAACTTTTCCGTCAAGCTGATTCACACCGTGCGCG
GCGTGGGCTATGTGCTCGAACTGAAGGACACGGCCTGA

Protein sequence :
MRILVIEDELKTAAYLKKGLEESGYAVDVANDGPQGLILALEEEYDVIVLDVMLPGMDGWGVVKTLRTTRTTPVLFLTAR
DDVDDRVRGLELGADDYLVKPFAFVELLARVRTLARRGPPRESELIKVGDLEMDVNRRRVKRGGTRIDLTPREFSLLQLL
ARRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRTKIDDNFSVKLIHTVRGVGYVLELKDTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-59 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-58 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-71 69
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-69 64
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0083 Protein 5e-68 63
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-59 62
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-64 58
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-64 58
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator BAC0347 Protein 4e-61 54
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 3e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-34 45
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 5e-32 43
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 4e-31 43
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 6e-34 42
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 7e-34 42
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-60 58
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator VFG1389 Protein 6e-40 50
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator VFG1390 Protein 8e-41 46
Bxe_B1389 YP_553925.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-36 43