Gene Information

Name : Bxe_B0815 (Bxe_B0815)
Accession : YP_554489.1
Strain :
Genome accession: NC_007952
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2462779 - 2463525 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGGACAATCCGAAGCGCATCCTGATCGTCGAAGACGACGTCGACATTGCCAACGTGCTGAGCCTTCATTTGCGCGACGA
GCGCTATGAAGTCGTGCATAGTGCCGACGGCAATGAAGGGCTGCGTCTGCTGGAACAGGGCGGCTGGGATGCGCTGATTC
TCGATCTGATGCTGCCCGGCGTCGACGGACTGGAAATCTGCCGGCGCGCCCGCGCGATGACACGCTATACGCCGATCATC
ATCACCAGCGCGCGTTCGAGCGAGGTGCACCGTATTCTCGGCCTCGAACTGGGCGCGGACGACTATCTCGCCAAGCCGTT
CTCCGTGCTGGAACTGGTGGCGCGCGTCAAGGCTCTGCTGCGCCGCGTCGACGCCCTCGCGAAAGATTCGCGGATCGAAG
CCGGCAATCTGCGGATTGCCGGGCTCTCGATCGATCCGCTCACGCGCGAGGCGGCCGCCAACGGCAAGCCGATCGAACTC
ACACCGCGCGAATTCGACCTGCTGTATTACTTCGCGCAGCATCCCGGCAAGGTGTTCTCGCGAATGGACCTGCTCAATGC
CGTGTGGGGCTATCAGCACGAGGGCTACGAGCACACCGTCAACACGCATATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCGGCCCAGCCCGAGCGCATCCTGACCGTCTGGGGACGCGGCTACAAGCTCGCCGTGCCTGGAGAGACACCCGCGCCC
ACCGGCGCACCGAAGGACGCATCGTGA

Protein sequence :
MDNPKRILIVEDDVDIANVLSLHLRDERYEVVHSADGNEGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALAKDSRIEAGNLRIAGLSIDPLTREAAANGKPIEL
TPREFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPERILTVWGRGYKLAVPGETPAP
TGAPKDAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-72 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-72 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-43 46
Bxe_B0815 YP_554489.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-42 43
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-35 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-29 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-44 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator AE016830.1.gene1681. Protein 8e-43 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-36 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-41 42
Bxe_B0815 YP_554489.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-37 41
Bxe_B0815 YP_554489.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-34 41
Bxe_B0815 YP_554489.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-39 41
Bxe_B0815 YP_554489.1 two component transcriptional regulator AM180355.1.gene1830. Protein 3e-39 41
Bxe_B0815 YP_554489.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B0815 YP_554489.1 two component transcriptional regulator VFG1563 Protein 2e-72 62
Bxe_B0815 YP_554489.1 two component transcriptional regulator VFG1702 Protein 2e-72 62
Bxe_B0815 YP_554489.1 two component transcriptional regulator VFG1389 Protein 2e-30 44