Gene Information

Name : Bxe_B2069 (Bxe_B2069)
Accession : YP_553268.1
Strain :
Genome accession: NC_007952
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1089312 - 1089998 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAATTGCTGATTGTTGAAGACGAGCACAAGGTGGTGGACTACCTGCGCTCCGGTTTGACAGAGCAGGGCTGGGTCGT
CGACGTCGCGCTCGACGGCGAGGAAGGCATGCACCTGGCCACCGAATTCGATTACGACGTGATCGTCCTCGACGTGATGC
TGCCCAAACGCGACGGCTTCAGCGTGCTGAAGGCGCTGCGCATGCGCAAATCCACACCGGTCATCATGCTCACCGCGCGC
GATCACGTGAACGACCGCGTGCGCGGTCTGCGCGAAGGCGCGGACGACTACCTCACCAAACCCTTTTCGTTCCTCGAACT
GGTCGAACGCCTGCACGCGCTGGCGCGGCGCACCCGTTCACAGGAATCGACGCTGATTTCCGTCGGCGATCTGTTCGTCG
ATCTGATTGGCCGGCGCGCGACGCGCGACGGCGTGCGCCTCGACCTGACCGCCAAGGAATTCCAGCTGCTCAGCGTGCTG
GCGCGCCGGCAAGGCGACATTCTGTCGAAGACCGCGATTACCGAACTCGTGTGGGACGTCAATTTCGACAGTCACACCAA
CGTGGTCGAGACCGCGATCAAGCGGCTGCGCGCCAAGCTCGACGGCCCGTTTCCCTCCAAGCTGCTGCATACCGTGCGCG
GCATGGGTTACGTGCTCGAAGTGCGCGAGGAGGCGGAGCAGTCATGA

Protein sequence :
MKLLIVEDEHKVVDYLRSGLTEQGWVVDVALDGEEGMHLATEFDYDVIVLDVMLPKRDGFSVLKALRMRKSTPVIMLTAR
DHVNDRVRGLREGADDYLTKPFSFLELVERLHALARRTRSQESTLISVGDLFVDLIGRRATRDGVRLDLTAKEFQLLSVL
ARRQGDILSKTAITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPSKLLHTVRGMGYVLEVREEAEQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-49 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-48 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-58 56
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-52 55
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-58 55
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-44 51
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-53 51
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0308 Protein 7e-53 50
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-46 47
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator CP000675.2.gene1535. Protein 9e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 9e-33 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 41
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-49 52
Bxe_B2069 YP_553268.1 two component heavy metal response transcriptional regulator VFG1389 Protein 4e-38 50