Gene Information

Name : Csal_0102 (Csal_0102)
Accession : YP_572165.1
Strain : Chromohalobacter salexigens DSM 3043
Genome accession: NC_007963
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 126737 - 127408 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTGCTGGTGGAAGACGAAAGCAAGACCGCCGACTACCTTGCCAGGGGGCTGGGCGAGGCCGGATACCGGGT
CGAGGTGGCCCGGGACGGGCTGGACGGCCGGCACCTGATCGAGGAGGCCGACTTCGAGCTGATCATCCTCGACGTCATGT
TGCCGGGGCTCGACGGCTGGGAACTGCTGCGGCTGATCCGTCGCCATGGCCAGGTGCCGGTGTTGTTCCTGACCGCCCGG
GATGCCGTGGAATACCGGGTCAAGGGATTGGAGCTGGGCGCTGACGACTATCTGGTCAAACCCTTTTCTTTCGTCGAGCT
GCTGGCCCGGGTGAGGACGCTGCTGCGCCGTGGTCCGCTGCGGGAGCGGGAGCGCTTCCAGGTGGCCGATCTGCACATGG
ACGTGCTGAAACGCCGGGTCACGCGGGGCGAGACGCGGCTTGCGCTGACCAACAAGGAGTTCGCGCTGCTGCAGCTGCTG
CTCGAGCGCGAGGGCGAGGTATTGTCACGGACCTTGATCGCCTCCGAGGTGTGGGGCATGAACTTCGACAGCGACACCAA
TGTGGTGGAGGTGGCCGTGCGGCGGTTGCGGGCCAAGGTGGACGACCCCTTCACGCGTCGGCTGATTCACACCGAGCGGG
GCATGGGCTACGTGCTGGAGGACCGCGGTTGA

Protein sequence :
MRILLVEDESKTADYLARGLGEAGYRVEVARDGLDGRHLIEEADFELIILDVMLPGLDGWELLRLIRRHGQVPVLFLTAR
DAVEYRVKGLELGADDYLVKPFSFVELLARVRTLLRRGPLRERERFQVADLHMDVLKRRVTRGETRLALTNKEFALLQLL
LEREGEVLSRTLIASEVWGMNFDSDTNVVEVAVRRLRAKVDDPFTRRLIHTERGMGYVLEDRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-55 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-54 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-65 64
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-59 63
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-58 61
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-51 60
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-55 58
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-60 58
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-52 52
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 9e-30 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 5e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 6e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 5e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 7e-27 41
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-55 59
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-36 45
Csal_0102 YP_572165.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-27 41