Name : ureB (Pcryo_0881) Accession : YP_580146.1 Strain : Psychrobacter cryohalolentis K5 Genome accession: NC_007969 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0832 EC number : - Position : 1043714 - 1044049 bp Length : 336 bp Strand : + Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGATTCCGGGTGAATATCAATTAAAGAAAGGTGATATTGAACTGTGCGTAGGTCGCGACAGCTTTGTGATTGAAGTGGC CAATACCGGCGATCGCCCTATACAAGTGGGCTCTCACTATCACTTTGCTGAAACCAACAGCGCACTGAGCTTTGATCGTA AAAAAGCCTATGGTCATCGCCTAGCTATACCTGCTGGCACCGCTACGCGCTTTGAGCCGGGCCAAAAACGTGAGGTGTCG TTGCTGCCTTATGCCGGATTGCGCCGCATCTTTGGCTTTAGAGGTGAGGTGATGGGTGCGCTAGATGACAATTCAGATTC AGGAGAAACACGATGA Protein sequence : MIPGEYQLKKGDIELCVGRDSFVIEVANTGDRPIQVGSHYHFAETNSALSFDRKKAYGHRLAIPAGTATRFEPGQKREVS LLPYAGLRRIFGFRGEVMGALDDNSDSGETR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 8e-28 | 65 |
ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 8e-28 | 65 |
ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 8e-23 | 57 |
ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 1e-22 | 57 |
ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 8e-23 | 57 |
ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 8e-23 | 57 |