Gene Information

Name : czcR2 (Rmet_4465)
Accession : YP_586599.1
Strain :
Genome accession: NC_007974
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1061659 - 1062279 bp
Length : 621 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTGATTGTCGAAGACGAGCCGAAGGCCGGTGATTATCTGCTCAAGGGACTCACCGAGTCGGGCTTCGTGGC
CGATCTGGCCCGCGACGGCGTGGATGGGCTGGCCCACGCACGCGAGCAGCACTATGACCTGATCGTGCTCGACGTGATGC
TGCCCGGCATGGATGGCTGGCAGGTATTGCGCGAACTGCGCCGGGACAAGGACACGCCCGTGCTGTGCCTGACCGCGCGT
GACGAATTGTCCGATCGGCTCAAGGGGCTGGAACTGGGCGCAGACGACTACATGGTCAAGCCGTTCGCTTTTGCCGAACT
GGTGGCGCGTATCCGGACGATCCTGCGGCGTGGCCCGCTGCGCGAGAGCGAATTCATCGAGGTGGCCGACCTGCAGATCG
ACACCATCCGCCGCCGCGTGACCCGCGCGGGGCAGAAAATCGACCTCACCTCGAAGGAGTTCGCGCTGCTGCAATTGCTG
GCGCGGCGCCGTGGCGAGGTATTGTCACGCTCGCTGATTGCGTCGCAGGTCTGGGATATGAACTTCGACAGCAACACCAA
CGTCGTGGACGTGTCGATCCGACGCCTGCGTGCCAAGGTGGATGACCCGTTCCCGAACTAG

Protein sequence :
MRILIVEDEPKAGDYLLKGLTESGFVADLARDGVDGLAHAREQHYDLIVLDVMLPGMDGWQVLRELRRDKDTPVLCLTAR
DELSDRLKGLELGADDYMVKPFAFAELVARIRTILRRGPLRESEFIEVADLQIDTIRRRVTRAGQKIDLTSKEFALLQLL
ARRRGEVLSRSLIASQVWDMNFDSNTNVVDVSIRRLRAKVDDPFPN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-55 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-54 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 5e-64 68
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 6e-63 65
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 4e-53 63
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 6e-60 62
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 9e-60 61
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 3e-58 59
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 5e-52 55
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-38 45
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 7e-30 44
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 8e-30 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 8e-27 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 8e-27 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-26 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0039 Protein 8e-27 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0596 Protein 1e-26 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-33 42
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-25 42
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 1e-26 42
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 5e-27 42
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 5e-22 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family BAC0533 Protein 3e-22 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 5e-22 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 3e-22 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-31 41
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 3e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 9e-56 57
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-30 47
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 4e-33 44
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family VFG0473 Protein 2e-28 43
czcR2 YP_586599.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-33 43