Gene Information

Name : Dgeo_2844 (Dgeo_2844)
Accession : YP_594347.1
Strain :
Genome accession: NC_008010
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 180564 - 181310 bp
Length : 747 bp
Strand : -
Note : -

DNA sequence :
ATGAGAGATTCTGCGTATGGTTCCGGGACTGCTTTTTCTCTGCCGCCTGCCCGGGAGCCGGGCATGAAGACTGTCCTGAT
CGTGGAGGACAACGCGGGCGTACGTGACATGATCCGCGAGTACCTCGAGGAGCATGGCTATCGCGTCCGCGTTGCGTCCA
ACGGCCAAGAGGGCCTGCTGGAGGCGCGCCACCATCGCCCCGACCTGGTGCTGCTCGATGTGATGATGCCCGGCATGGAC
GGTCTGGAGTTCCTGCGCCGTTTCCGAGCCACCGAACAGGTGCCGGTGATCTTTCTGACGGCCCGGGACACCGAACTCGA
CAAGGTGCTGGGGCTGGAACTGGGCGCAGACGATTACGTGACCAAGCCCTTCTCCATGGCCGAACTGCTGGCCCGCGTGC
GCGCAAACTTACGCCGGAGCAGCGAGCCTCTCCCGAACGCGGTGCTGCGGGCCGGCGAACTCGAACTTGACCCCACCACA
CGGACCTTCCTGGTGCGAGGGGAACGGGTGGACCTCACCCGCTCGGAATTCGAGCTGATGTCGGCCTTCCTGCGGGCACC
CGGACGGGTCTTTACCCGACTGGAATTGCTGGAGCAGTTGCAGGAAGAGGCGCTGGGATCCGAGCGCACCATCGATGTCC
ACGTCCGCAACCTGCGGGCCAAGATCGAGGCGGAGCCGGGCAAGCCGCGGCTGATCGAGACGGTCTTTGGGGTGGGATAC
CGGCTCAACCCGGATCTGAACCCGTGA

Protein sequence :
MRDSAYGSGTAFSLPPAREPGMKTVLIVEDNAGVRDMIREYLEEHGYRVRVASNGQEGLLEARHHRPDLVLLDVMMPGMD
GLEFLRRFRATEQVPVIFLTARDTELDKVLGLELGADDYVTKPFSMAELLARVRANLRRSSEPLPNAVLRAGELELDPTT
RTFLVRGERVDLTRSEFELMSAFLRAPGRVFTRLELLEQLQEEALGSERTIDVHVRNLRAKIEAEPGKPRLIETVFGVGY
RLNPDLNP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-34 46
Dgeo_2844 YP_594347.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-33 44
Dgeo_2844 YP_594347.1 two component transcriptional regulator BAC0197 Protein 6e-31 43
Dgeo_2844 YP_594347.1 two component transcriptional regulator BAC0638 Protein 2e-26 42
Dgeo_2844 YP_594347.1 two component transcriptional regulator BAC0083 Protein 1e-31 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-34 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-36 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-35 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-32 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-33 41
Dgeo_2844 YP_594347.1 two component transcriptional regulator CP001918.1.gene5135. Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2844 YP_594347.1 two component transcriptional regulator VFG1390 Protein 5e-33 45
Dgeo_2844 YP_594347.1 two component transcriptional regulator VFG1386 Protein 6e-32 43
Dgeo_2844 YP_594347.1 two component transcriptional regulator VFG0596 Protein 3e-33 42
Dgeo_2844 YP_594347.1 two component transcriptional regulator VFG1389 Protein 3e-24 42