Gene Information

Name : Dgeo_0195 (Dgeo_0195)
Accession : YP_603667.1
Strain : Deinococcus geothermalis DSM 11300
Genome accession: NC_008025
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 181505 - 182173 bp
Length : 669 bp
Strand : +
Note : PFAM: response regulator receiver: (1.8e-38) transcriptional regulatory protein-like: (2.9e-23); KEGG: dra:DR0781 response regulator, OmpR/PhoB family, ev=1e-121, 95% identity

DNA sequence :
ATGGACCAACGCATCCTCCTTATTGAAGACAATCCGGACATCACCCGTGTCGTCCAGTACGAGCTGGAACAGGCTGGGTA
TCGGGTGCTCACAGCGCCAGATGGAGTCACGGGCCTCACCAGCGCGCGCGAGAACAGCCCGGATCTGGTGATTCTCGACC
TCGGATTGCCCGACTTCGACGGCGCTGAGATCGCCCGCCGCCTGCGCAAGACCAGCAGCGTCCCCATCATCATCCTGACC
GCGATGGATGCTGTGGACCGCAAGGTGAACCTGCTGGAGGCGGGCGCGGATGACTATATGACCAAGCCCTTCCACCCAGA
GGAACTGGTGGCCCGCGTCAAGGTGCAGCTCCGGCACCAGCAGCACGGCGAGGTGATCTCCATCGGCGCGCTGGAAATCC
ACCCGCAAAAGCGGCTGTGCCACTACAACGGCCACGAGGTGCGCCTCTCGCCCAAGGAGTTCGATCTGCTGACCTTCCTG
GCCCGCCAGCCTGGCCGGGTGTACTCACGCCAGGAAATCGAGCGCGAGGTCTGGAACGGCGAACTGCCCAGCAACTCGAA
CGTGGTGGACGTGCATATGGCCAATATGCGCGCCAAGCTGCGCGATCTCGACGGCTACGGGATCATCCGGACCGTGCGCG
GCATCGGGTACGCGCTCAAGACGCCCTGA

Protein sequence :
MDQRILLIEDNPDITRVVQYELEQAGYRVLTAPDGVTGLTSARENSPDLVILDLGLPDFDGAEIARRLRKTSSVPIIILT
AMDAVDRKVNLLEAGADDYMTKPFHPEELVARVKVQLRHQQHGEVISIGALEIHPQKRLCHYNGHEVRLSPKEFDLLTFL
ARQPGRVYSRQEIEREVWNGELPSNSNVVDVHMANMRAKLRDLDGYGIIRTVRGIGYALKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-36 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-37 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator BAC0197 Protein 2e-32 42
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 41
Dgeo_0195 YP_603667.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0195 YP_603667.1 two component transcriptional regulator VFG0596 Protein 1e-31 43
Dgeo_0195 YP_603667.1 two component transcriptional regulator VFG1389 Protein 4e-31 42