
|
Name : ureA (TM1040_0387) Accession : YP_612382.1 Strain : Ruegeria sp. TM1040 Genome accession: NC_008044 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : - Position : 395402 - 395704 bp Length : 303 bp Strand : - Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : ATGAATCTGACACCGAGAGAAAAAGACAAGCTTCTGGTCGCGATGGCGGCCGAAGTCGCCCGCAAGCGACTGGCGCGCGG GGTGAAACTCAATCATCCAGAGGCAATCGCGCTCATTACCGATGCCGTGGTCGAGGGGGCGCGCGACGGCAGATCGGTAG CGGAGATGATGCAGGCGGGGGCCGAGGTCATCACCCGCGATCAATGCATGAGCGGCGTGGCCGAGATGATCCACGAAGTG CAGGTCGAGGCCACTTTTCCCGACGGCACCAAGCTCGTGACCGTACACAACCCCATCCGTTGA Protein sequence : MNLTPREKDKLLVAMAAEVARKRLARGVKLNHPEAIALITDAVVEGARDGRSVAEMMQAGAEVITRDQCMSGVAEMIHEV QVEATFPDGTKLVTVHNPIR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 4e-30 | 65 |
| ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 4e-30 | 65 |
| ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 4e-30 | 65 |
| ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 4e-30 | 65 |
| ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 2e-26 | 65 |
| ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 2e-26 | 65 |