Gene Information

Name : Bcen_4929 (Bcen_4929)
Accession : YP_624778.1
Strain :
Genome accession: NC_008061
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2195703 - 2196011 bp
Length : 309 bp
Strand : +
Note : PFAM: transposase IS3/IS911; KEGG: rso:RSc2314 probable transposase protein

DNA sequence :
ATGAGCAAGCAACGACGTACGTTTTCCCCGGAGTTCAAACAGCAAGCCGCCTGTCTGGTGCTCGACCAGGGTTATAGCCA
TATGGAAGCAAGCCGCTCGGTCGGCGTCGGCGAGACGGTGCTGCGCCGCTGGGTGCAGCAACTTCAGATGGAACGCCAGG
GCGTCACGCCGCAGGGCAAGGCAATCACGCCGGATCAACAGCGTATTCAGGAACTCGAGGCGCGTATCGAACGCCTCGAG
CGTGAGAAGGCCATTTTAAAAAAGGCTACCGCGCTCTTGATGTCGGAAGGCATCGAACGTACGAAGTAA

Protein sequence :
MSKQRRTFSPEFKQQAACLVLDQGYSHMEASRSVGVGETVLRRWVQQLQMERQGVTPQGKAITPDQQRIQELEARIERLE
REKAILKKATALLMSEGIERTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 3e-23 75
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-14 56
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-14 56
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-13 55
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-13 55
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-13 55
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-13 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-14 51
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-14 51
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 51
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 51
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-14 51
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 51
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-14 51
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 51
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 51
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-14 47
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-14 47
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-12 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen_4929 YP_624778.1 transposase IS3/IS911 VFG0784 Protein 2e-13 55
Bcen_4929 YP_624778.1 transposase IS3/IS911 VFG1553 Protein 6e-15 51
Bcen_4929 YP_624778.1 transposase IS3/IS911 VFG1123 Protein 2e-14 51
Bcen_4929 YP_624778.1 transposase IS3/IS911 VFG1485 Protein 2e-14 47