Gene Information

Name : Mmcs_4301 (Mmcs_4301)
Accession : YP_641462.1
Strain : Mycobacterium sp. MCS
Genome accession: NC_008146
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4568811 - 4569503 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: mpa:MAP0916 two-component response regulator

DNA sequence :
GTGCCTGTGCGCATACTTGTCGTCGACGACGATCGCGCGGTGCGAGAATCCCTGCGCCGGTCCCTGTCCTTCAACGGATA
TTCGGTCGAGTTGGCCCAGGACGGTGTCGAAGCTCTCGACCTGATCGCCAACAACCGGCCCGACGCCGTGGTGCTGGACG
TGATGATGCCCCGGCTCGACGGCCTCGAGGTGTGCCGGCAGCTTCGCAGCACCGGCGACGACCTGCCGATCCTGGTGCTG
ACGGCCCGTGACTCGGTGTCCGAGCGGGTCGCCGGACTCGATGCCGGCGCCGACGACTACCTGCCCAAACCGTTCGCGCT
CGAGGAACTGCTCGCGCGGATGCGGGCCCTGCTGCGCCGCACCTCCCCCGACGAGGGCCCCGATTCCCCGGCGCTGACCT
TTCTCGATCTGACCCTGGACCCGGTCACCCGCGAGGTGACCCGCGGGTCCCGGCAGATCAGCCTCACCCGCACCGAGTTC
GCGTTGCTGGAGATGCTGATCGCCAATCCGCGCCGCGTGCTCACCCGCAGCCGCATCCTCGAGGAAGTGTGGGGCTTCGA
CTTCCCGACCTCGGGGAACGCGCTCGAGGTGTACATCGGCTATCTGCGCCGGAAGACCGAAGCGTCCGGGGAGCCGCGAC
TGATCCACACCGTGCGCGGTGTGGGGTACGTGCTCCGCGAGACGCCCCCCTGA

Protein sequence :
MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTSPDEGPDSPALTFLDLTLDPVTREVTRGSRQISLTRTEF
ALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEASGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0083 Protein 1e-32 46
Mmcs_4301 YP_641462.1 two component transcriptional regulator HE999704.1.gene1528. Protein 9e-39 44
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0125 Protein 3e-34 44
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0308 Protein 1e-33 43
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0111 Protein 1e-34 43
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0638 Protein 4e-27 43
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-33 42
Mmcs_4301 YP_641462.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 42
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-33 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator AE015929.1.gene1106. Protein 9e-30 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-24 41
Mmcs_4301 YP_641462.1 two component transcriptional regulator BAC0197 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmcs_4301 YP_641462.1 two component transcriptional regulator VFG1390 Protein 9e-87 91
Mmcs_4301 YP_641462.1 two component transcriptional regulator VFG1389 Protein 5e-43 52
Mmcs_4301 YP_641462.1 two component transcriptional regulator VFG1386 Protein 2e-44 51
Mmcs_4301 YP_641462.1 two component transcriptional regulator VFG0596 Protein 4e-33 42