Gene Information

Name : Mmcs_4448 (Mmcs_4448)
Accession : YP_641608.1
Strain : Mycobacterium sp. MCS
Genome accession: NC_008146
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4731699 - 4732400 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: mbo:Mb0927c two component response transcriptional regulatory protein PrrA

DNA sequence :
ATGGACAGTGGTGTGGGATCGCCCCGGGTACTGGTCGTCGACGACGACCCCGACGTGCTGGCGTCGCTGGAACGCGGGTT
GCGGCTGTCCGGGTTCGACGTGTCCACCGCGGTGGACGGCGCCGAGGCGCTGCGCAGCGCCACCGAGACGCGCCCCGATG
CGATCGTCCTCGACATCAACATGCCGGTGCTCGACGGCGTCAGCGTGGTCACGGCGTTGCGCGCGATGGACAACGACGTG
CCGGTCTGCGTGCTGAGCGCGCGCAGCAGTGTCGACGACCGGGTGGCCGGTCTGGAGGCGGGCGCCGACGACTACCTCGT
CAAACCCTTCGTGCTGGCCGAGCTGGTGGCCCGGGTCAAGGCACTGTTGCGTCGGCGGGGTTCGTCGGCGACCTTCTCGT
CGGAGACCATCCAGGTCGGCCCGCTCGAGGTCGACATCCCCGGCCGGCGGGCCCGTGTCAACGGCGTCGACGTCGACCTG
ACCAAACGTGAATTCGACCTGCTGGCGGTGCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGCGCCCAGTTGCTCGAACT
GGTCTGGGGTTACGACTTCGCCGCCGACACCAACGTCGTCGACGTGTTCATCGGATACCTGCGCCGCAAGCTCGAGGCGG
GCGGCGCGCCCCGCCTGCTGCACACCGTGCGGGGTGTGGGATTCGTCCTCCGGACCCAATAG

Protein sequence :
MDSGVGSPRVLVVDDDPDVLASLERGLRLSGFDVSTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMDNDV
PVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSSATFSSETIQVGPLEVDIPGRRARVNGVDVDL
TKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0083 Protein 6e-32 46
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0125 Protein 2e-30 45
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0197 Protein 7e-25 44
Mmcs_4448 YP_641608.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-28 44
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-32 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-27 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0638 Protein 5e-24 42
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0308 Protein 4e-27 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator BAC0111 Protein 8e-27 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-28 41
Mmcs_4448 YP_641608.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmcs_4448 YP_641608.1 two component transcriptional regulator VFG1389 Protein 4e-84 96
Mmcs_4448 YP_641608.1 two component transcriptional regulator VFG1390 Protein 2e-41 50
Mmcs_4448 YP_641608.1 two component transcriptional regulator VFG1386 Protein 8e-36 45
Mmcs_4448 YP_641608.1 two component transcriptional regulator VFG0596 Protein 7e-26 42