Gene Information

Name : Rxyl_2983 (Rxyl_2983)
Accession : YP_645705.1
Strain : Rubrobacter xylanophilus DSM 9941
Genome accession: NC_008148
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2988309 - 2988995 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: mta:Moth_0070 two component transcriptional regulator, winged helix family

DNA sequence :
TTGCAGGGTACGACGCGCAGGATCCTCCTGGTAGACGACGAGCCGTCGCTCCAGAAGATGCTGACGCACGCCCTGGAGCG
GGAGGGGTTCCAGGTGCAGGCCGTCGGGGACGGCGAGGCGGCGCTCGAGGCCTTCAACACCTTCGAGCCGCACCTGATCA
TCCTGGACATCATGCTCCCCAAGCTGGACGGGACCGAGGTCTGCCGCAGGATCCGGGCGCAGAGCGACGTGCCGATCCTG
ATGCTCACCGCCAAGGACGACGAGATAGACCGGGTGGTGGGGCTGGAGCTCGGGGCCGACGACTACGTCACCAAGCCCTT
CGCCGTGCGGGAGCTGGTGGCGCGGGTCAGGGCCATCATGCGCCGGGCGCAGGTCCCCGCCGGACAGCGGCCGGACGAGC
TCAACTACGACGGGCTGAAGATAAACCTCCCCAGCCGCCGGGTCTCGGTGGACGGGCGGGAGGTGGACCTGACCTACACC
GAGTTTGAGCTTCTGGTGACCCTGGCCTCCAACCCGGGCAAGGTGTTCTCCCGGAGCGCCCTGCTGCGCCGGGTGTGGGG
CGACGAGTTCCGCGACGAGCGCACGGTCGACGTGCACATCCGCCACCTCCGGGAGAAGATAGAGCGCGACCCCCGCAACC
CCGAGTTCATCCACACCGCGCGGGGTGTCGGGTATGTCTTCCGCTAG

Protein sequence :
MQGTTRRILLVDDEPSLQKMLTHALEREGFQVQAVGDGEAALEAFNTFEPHLIILDIMLPKLDGTEVCRRIRAQSDVPIL
MLTAKDDEIDRVVGLELGADDYVTKPFAVRELVARVRAIMRRAQVPAGQRPDELNYDGLKINLPSRRVSVDGREVDLTYT
EFELLVTLASNPGKVFSRSALLRRVWGDEFRDERTVDVHIRHLREKIERDPRNPEFIHTARGVGYVFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-47 52
Rxyl_2983 YP_645705.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-46 49
Rxyl_2983 YP_645705.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-45 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-47 48
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-46 47
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0197 Protein 1e-35 46
Rxyl_2983 YP_645705.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-45 45
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-41 44
Rxyl_2983 YP_645705.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-37 44
Rxyl_2983 YP_645705.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-41 44
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0125 Protein 4e-36 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator AE016830.1.gene1681. Protein 9e-43 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000034.1.gene3834. Protein 3e-30 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 6e-35 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-30 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002695.1.915041.p Protein 3e-30 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-36 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000034.1.gene3671. Protein 3e-42 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0596 Protein 1e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-37 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0039 Protein 3e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-38 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-40 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0308 Protein 2e-32 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-40 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-40 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 7e-36 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0083 Protein 2e-35 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP004022.1.gene3215. Protein 4e-33 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-25 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-30 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator CP001485.1.gene721.p Protein 9e-39 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0533 Protein 2e-30 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-38 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-38 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator BAC0638 Protein 5e-32 42
Rxyl_2983 YP_645705.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-34 41
Rxyl_2983 YP_645705.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 6e-36 41
Rxyl_2983 YP_645705.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 8e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_2983 YP_645705.1 two component transcriptional regulator VFG1389 Protein 3e-35 44
Rxyl_2983 YP_645705.1 two component transcriptional regulator VFG1390 Protein 2e-40 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator VFG0596 Protein 5e-31 43
Rxyl_2983 YP_645705.1 two component transcriptional regulator VFG1563 Protein 7e-38 41